KEGG   Ralstonia eutropha H16: H16_B0243Help
Entry
H16_B0243         CDS       T00416                                 

Gene name
cheB1
Definition
(GenBank) chemotaxis specific response regulator containing a methylesterase domain
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
reh  Ralstonia eutropha H16
Pathway
reh02020  Two-component system
reh02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:reh00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    H16_B0243 (cheB1)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    H16_B0243 (cheB1)
Enzymes [BR:reh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     H16_B0243 (cheB1)
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     H16_B0243 (cheB1)
Two-component system [BR:reh02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   H16_B0243 (cheB1)
Bacterial motility proteins [BR:reh02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    H16_B0243 (cheB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: CAJ95044
UniProt: Q0K4N0
Position
2:271298..272380
Genome map
AA seq 360 aa AA seqDB search
MTAAKIKVLCVDDSALIRSLMTEIINSQPDMEVVGTAPDPLVARDLIKRLNPDVLTLDVE
MPRMDGLDFLERLMRLRPMPVLMVSSLTERGSEITMRALELGAVDFVTKPKLGIRDGLLE
YTHTIADKLRAASRARVRAAAQPAAPTAAGTEPVPMLRSPLLSTEKLIILGASTGGTEAI
KEFLMPLPPDSPAVMIVQHMPAGFTRSFAQRLDGLCRITVKEAVHGERVLPGHAYIAPGD
SHLLLARSGANYVAHLSQEAPVNRHRPSVDVLFDSAAQHGGKNVIGVILTGMGRDGARGM
LRMREAGAYNLAQDEHTCIVFGMPKEAIATGGVHEVVPLPAMTQRVMARLATYGTRAQRV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacagccgccaagatcaaggtgctctgcgtggacgattccgcgctgatccgcagcctg
atgacggagatcatcaacagccagcccgacatggaagtggtgggcaccgcgcccgacccg
ctggtggcgcgcgacctgatcaagcgcctgaacccggatgtgctgacgctggacgtcgaa
atgccgcgcatggacggcctggacttcctggaacgcctgatgcggctgcggccgatgccg
gtgctgatggtgtcgtcgctgaccgagcgcggttccgagatcaccatgcgcgcgctggag
ctgggcgccgtggactttgtcaccaagcccaagctgggcatccgcgacgggctgctggaa
tacacccacaccatcgccgacaagctgcgcgccgcgtcgcgcgcccgcgtgcgcgcggcc
gcgcaaccggccgcgccgacggcggccggcaccgagcccgtgccgatgctgcgcagcccg
ctgctgtcgaccgaaaagctgatcatcctgggcgcctccaccggcggcaccgaggccatc
aaggaattcctgatgccgctgccgcccgacagcccggcggtcatgatcgtccagcatatg
ccggccggctttacgcgctcgttcgcgcagcggctggatggcctgtgccgcatcaccgtc
aaggaagccgtgcacggcgagcgcgtgctgcccggccatgcgtatatcgcgccgggcgat
tcgcacctgctgctcgcgcgcagcggcgccaactatgtcgcgcacctgtcgcaggaagcg
ccggtgaatcgccaccgcccgtcggtcgacgtgctgttcgattcggccgcgcagcatggc
ggcaagaacgtgatcggcgtgatcctgaccggcatgggccgcgacggcgcgcgcggcatg
ctgcgcatgcgcgaggccggtgcctataacctggcccaggacgagcacacatgcattgtg
tttggcatgccgaaggaggcgatcgccaccggcggcgtgcatgaagtcgtgcccttgccg
gcgatgacccagcgcgtgatggcacgcctggccacatacggcacgcgcgcgcagcgggtg
taa

DBGET integrated database retrieval system