KEGG   Ralstonia eutropha H16: H16_B0243Help
Entry
H16_B0243         CDS       T00416                                 

Gene name
cheB1
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
reh  Ralstonia eutropha H16
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:reh02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:reh02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:271298..272380
Genome map
AA seq 360 aa AA seqDB search
MTAAKIKVLCVDDSALIRSLMTEIINSQPDMEVVGTAPDPLVARDLIKRLNPDVLTLDVE
MPRMDGLDFLERLMRLRPMPVLMVSSLTERGSEITMRALELGAVDFVTKPKLGIRDGLLE
YTHTIADKLRAASRARVRAAAQPAAPTAAGTEPVPMLRSPLLSTEKLIILGASTGGTEAI
KEFLMPLPPDSPAVMIVQHMPAGFTRSFAQRLDGLCRITVKEAVHGERVLPGHAYIAPGD
SHLLLARSGANYVAHLSQEAPVNRHRPSVDVLFDSAAQHGGKNVIGVILTGMGRDGARGM
LRMREAGAYNLAQDEHTCIVFGMPKEAIATGGVHEVVPLPAMTQRVMARLATYGTRAQRV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacagccgccaagatcaaggtgctctgcgtggacgattccgcgctgatccgcagcctg
atgacggagatcatcaacagccagcccgacatggaagtggtgggcaccgcgcccgacccg
ctggtggcgcgcgacctgatcaagcgcctgaacccggatgtgctgacgctggacgtcgaa
atgccgcgcatggacggcctggacttcctggaacgcctgatgcggctgcggccgatgccg
gtgctgatggtgtcgtcgctgaccgagcgcggttccgagatcaccatgcgcgcgctggag
ctgggcgccgtggactttgtcaccaagcccaagctgggcatccgcgacgggctgctggaa
tacacccacaccatcgccgacaagctgcgcgccgcgtcgcgcgcccgcgtgcgcgcggcc
gcgcaaccggccgcgccgacggcggccggcaccgagcccgtgccgatgctgcgcagcccg
ctgctgtcgaccgaaaagctgatcatcctgggcgcctccaccggcggcaccgaggccatc
aaggaattcctgatgccgctgccgcccgacagcccggcggtcatgatcgtccagcatatg
ccggccggctttacgcgctcgttcgcgcagcggctggatggcctgtgccgcatcaccgtc
aaggaagccgtgcacggcgagcgcgtgctgcccggccatgcgtatatcgcgccgggcgat
tcgcacctgctgctcgcgcgcagcggcgccaactatgtcgcgcacctgtcgcaggaagcg
ccggtgaatcgccaccgcccgtcggtcgacgtgctgttcgattcggccgcgcagcatggc
ggcaagaacgtgatcggcgtgatcctgaccggcatgggccgcgacggcgcgcgcggcatg
ctgcgcatgcgcgaggccggtgcctataacctggcccaggacgagcacacatgcattgtg
tttggcatgccgaaggaggcgatcgccaccggcggcgtgcatgaagtcgtgcccttgccg
gcgatgacccagcgcgtgatggcacgcctggccacatacggcacgcgcgcgcagcgggtg
taa

DBGET integrated database retrieval system