KEGG   Ralstonia eutropha H16: H16_B0386Help
Entry
H16_B0386         CDS       T00416                                 

Gene name
h16_B0386
Definition
(GenBank) Acetyl-CoA synthetase (NDP-forming)
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00010  Glycolysis / Gluconeogenesis
reh00620  Pyruvate metabolism
reh00640  Propanoate metabolism
reh00680  Methane metabolism
reh01100  Metabolic pathways
reh01110  Biosynthesis of secondary metabolites
reh01120  Microbial metabolism in diverse environments
reh01130  Biosynthesis of antibiotics
reh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H16_B0386 (h16_B0386)
   00620 Pyruvate metabolism
    H16_B0386 (h16_B0386)
   00640 Propanoate metabolism
    H16_B0386 (h16_B0386)
  Energy metabolism
   00680 Methane metabolism
    H16_B0386 (h16_B0386)
Enzymes [BR:reh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     H16_B0386 (h16_B0386)
Lipid biosynthesis proteins [BR:reh01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   H16_B0386 (h16_B0386)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_5 Succ_CoA_lig CoA_binding_2 CoA_binding ATP-grasp_2
Motif
Other DBs
NCBI-ProteinID: CAJ95185
UniProt: Q0K489
Position
2:437842..439986
Genome map
AA seq 714 aa AA seqDB search
MSTRDLYTHAQLRRLFHPRTIAVVGATPNARSFAGRAMTNLQQFDGNVLLVNPRYPEVNG
QVCYPSLSALPEAPDCVLIATARETVEPIVRECAGLGVGGVVLFASGYAETGNPEQIAEQ
ARLVAIARESGMLLLGPNSIGYANYINHALVSFTPLPARGGELPAHAIGLVSQSGALAFA
LEQAANHGTAFSHVFSCGNACDIDVTDQIAYLAGDPSCAAIACVFEGLSDASRIIRAAQV
CAEAGKPLVVYKMARGTAGAAAAMSHTGSMAGSDRAYSTALREAGVVQVDTIEQLVPTTV
FFAKAPRPTTSGVAIVSGSGGAGIVAADEAERFNVPLPQPCDATRAVLESHIPDFGAARN
PCDLTAQAANNFDSFIQCGDAVFADPAYGAAVVPLVVTGDGNGRRFQVFNDLAVKHGKMA
CGLWMSNWMEGPEAVESEALPRLALFRSVSHCFAALAAWQAREQWLLSRATPKPPRLTHA
SVAAEARARIVAAPADTLTEREAKDVLAMYGVPVVGESLATSEQDAVRAADACGYPVVLK
VESPAIPHKSEAGVIRLGVNSAQEVAVAYREVMANARKVTADDRINGVLVQSQVPTGIEI
LVGARVDPHLGALLVVGLGGVMVELMQDTVATIAPCSAQQARAMLEQLRGVALLKGFRGA
AGVDMDLLAEIVASLSEFAADQRDVIAEFDVNPLICTPDRIVAVDALIERRVGA
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacacgcgatctctatacccacgcgcaactgcggcgcctcttccatccgcgcacc
atcgcggtggtcggcgcgacgccgaacgctcgctcgttcgccggccgggccatgacgaac
ctgcagcagttcgacggcaacgtgctgctggtcaacccccgctaccccgaggtgaacggg
caggtctgctatccgtcgctgtcggcgctgcccgaggcgcccgactgcgtgctgatcgcc
accgcgcgcgaaacggtggagcccatcgtgcgcgagtgcgcggggctgggcgtgggcggc
gtggtgctgttcgcgtcgggctatgccgagaccggcaatccggagcagattgccgagcag
gctcggctggtcgccattgcccgggaaagcggcatgctgctgctcggtccgaacagcatc
ggctatgcgaactacatcaaccatgcgctggtgtcgttcacgccgctgcccgcgcgtggc
ggcgaactgccggcccatgcgatcgggctggtcagccagtccggcgcgctggcatttgcg
ctggaacaggcggccaaccacggcacggcgttcagccacgtgttctcgtgcggcaatgcg
tgcgatatcgacgtgaccgaccagatcgcctatctcgccggggatccctcgtgcgcggcg
atcgcatgcgtattcgaagggctgtccgacgccagccggatcattcgcgcggcgcaagtc
tgcgcggaagccggcaagccgctggtggtctacaagatggcgcgcgggacggcgggcgcg
gcggcggccatgtcgcataccggctcgatggcgggatccgaccgcgcctacagcacggcg
ctgcgcgaagctggcgtggtgcaggtcgataccatcgagcagctcgtgccgacgacggtg
ttcttcgccaaggccccccggccgacgacgtccggcgtggccatcgtctcgggttcgggc
ggcgcgggcattgtcgccgccgacgaggccgagcgtttcaacgtgccgctgccgcagccg
tgtgacgcgacccgcgccgtgctcgaatcgcacattcctgacttcggcgccgcgcgcaac
ccgtgcgacctgaccgcccaggccgccaacaacttcgactccttcatccagtgcggcgac
gcggtcttcgccgatcccgcctacggcgccgccgtggtgccgctggtggtgaccggcgac
ggcaacggccgccgcttccaggtgttcaacgacctagccgtcaagcacggcaagatggcg
tgcggcctgtggatgtcgaactggatggaagggccggaggcggtcgagtccgaggcgctg
ccgcgccttgcgctgttccgctcggtctcgcactgcttcgcggcgctggccgcgtggcag
gcacgggagcaatggctgttgtcgcgcgccacgccgaagccgccgcgcctgacacacgct
tcggtggccgccgaagcgcgcgcgcgcatcgttgccgcgccggccgatacgctcaccgag
cgtgaagccaaggacgtccttgccatgtacggcgtgccggtggtgggcgagtccctggcg
acgagcgagcaggacgccgtgcgcgccgccgatgcctgcggctatccggtcgtgctgaag
gtcgagagcccggccatcccgcacaagtcggaagcgggcgtgatccgcctcggcgtgaac
tcggcgcaggaggttgccgtcgcgtaccgcgaggtcatggcgaatgcgcgcaaggtgacc
gccgacgaccgcatcaacggcgtgctggtgcagagccaggtgccgaccggcatcgagatc
ttggtcggcgcccgcgtggacccgcacctcggcgcgctgctggtggtggggctgggcggg
gtgatggtcgagctgatgcaggacacggtcgcgaccatcgcgccgtgctcggcgcagcag
gcgcgcgccatgctggagcagctgcgcggcgtggcgctgctgaagggcttccgcggcgcg
gcgggcgtggacatggacctgctggcggaaatcgtcgccagcctgtccgagttcgcggcg
gaccagcgcgacgtgatcgccgagttcgatgtgaatccgctgatctgcacgccggaccgc
atcgtggcggtggatgcgctgatcgaacggagagtgggggcctga

DBGET integrated database retrieval system