KEGG   Ralstonia eutropha H16: H16_B0551Help
Entry
H16_B0551         CDS       T00416                                 

Gene name
mhpF
Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00360  Phenylalanine metabolism
reh00362  Benzoate degradation
reh00620  Pyruvate metabolism
reh00621  Dioxin degradation
reh00622  Xylene degradation
reh00650  Butanoate metabolism
reh01100  Metabolic pathways
reh01120  Microbial metabolism in diverse environments
reh01220  Degradation of aromatic compounds
Module
reh_M00569  Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    H16_B0551 (mhpF)
   00650 Butanoate metabolism
    H16_B0551 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    H16_B0551 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    H16_B0551 (mhpF)
   00622 Xylene degradation
    H16_B0551 (mhpF)
   00621 Dioxin degradation
    H16_B0551 (mhpF)
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     H16_B0551 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA F420_oxidored
Motif
Other DBs
NCBI-ProteinID: CAJ95348
UniProt: Q0K3S6
Position
2:620617..621561
Genome map
AA seq 314 aa AA seqDB search
MDMKASGHHKVAIIGSGNIGTDLMIKVMRHGRSLEMGAMVGIDAASDGLARAARLGVPTT
AEGIDGLVGMPGFGDIRIAFDATSAGAHAHHNRVLQQHGVRVIDLTPASIGPYVVPVVNL
DQHLDAPNINMVTCGGQATIPMVAAVSRVARVHYAEIVASISSRSAGPGTRANIDEFTET
TSQALCSVGGAARGKAIIVLNPAEPPLMMRDTVFTLSEDGDEAEIAASVEAMAQAVQGYV
PGYRLKQRVQFERIAASAPLNIPGLGPMSGLKTSIFLEVEGAAHYLPAYAGNLDIMTSAA
LACAERLAETRLSA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggacatgaaagcaagcggccaccacaaggtggccatcatcggctccggcaatatcggc
accgacctgatgatcaaggtaatgcgccacggccggagcctggagatgggcgccatggtg
ggcatcgatgccgcgtcggacgggctggcccgcgccgcgcgcctgggcgtgccgaccacg
gccgagggcatcgacgggctggtcggcatgccgggcttcggcgatatccgcatcgccttc
gatgccacctcggccggtgctcatgcgcatcacaaccgcgtgctgcagcagcacggcgtg
cgcgtgatcgacctgacgccggcgtcgatcggcccgtacgtggtgcccgtggtcaacctg
gaccagcacctggatgcccccaacatcaatatggtcacctgcggcggccaggccaccatc
cccatggtggcggcggtgtcgcgcgtggccagagtgcactacgccgagatcgtggcgtcg
atctcgagcaggtcggccgggccgggcacgcgcgccaatatcgacgagttcaccgagacc
accagccaggcgctgtgctcggtgggcggcgccgcgcgcggcaaggccatcatcgtgctc
aacccggcggaaccgccgctgatgatgcgcgacacggtcttcacgttgtcggaggacggc
gatgaagcggaaattgcggcgagcgtcgaagcgatggcgcaggcagtgcagggctacgta
ccgggttaccggctcaagcagcgcgtgcagttcgagcgtatcgccgcgtcggcgccattg
aatatccccggactgggaccgatgagcgggctcaagacctcgatcttcctggaagtggag
ggcgccgcccattacctgccggcctatgccggcaacctcgacatcatgaccagcgccgca
ctggcctgcgccgagcgcctggccgagacccggctgtccgcatga

DBGET integrated database retrieval system