KEGG   Ralstonia eutropha H16: H16_B0558Help
Entry
H16_B0558         CDS       T00416                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
reh  Ralstonia eutropha H16
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    H16_B0558
Enzymes [BR:reh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     H16_B0558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(629052..630857)
Genome map
AA seq 601 aa AA seqDB search
MKATGTFFFVVGPSGAGKDSLIDGARAALDGDYVFARRVITRPDGSAGEEHEGVTEAEFA
RRQRSGEFLVTWDAHDLRYGLPKSLMCELERGRNVVANGSRGVIAELAARLPRFVVVLVT
APHDVLARRIAARGRESGDQVASRVARAGAPVPPHVPCITVSNHSTLEAGTARFVEALRT
GTRTSAAERPASRTNLMAKLRGEPLDEAAYVAVLQDAIAGRYTEAELTEFLVAATRTLTD
EEVVALARARTAFTPRIDWDEPVVVDKHSMGGVPGSRITLIVVPIVAAYGLAMPKTSSRA
ITSAAGTADAMETIARVDLAHEDVRRCVAQARACIAWNGRLNHSVVDDVMNAITRPLRLD
SRRWSVASILSKKYTAGATHVIVDLPYGPQTKLATRADAEALGALFEHVGKGLGLHVRAL
VTDGSGPIGRGIGPALEVRDVRLVLDNAPDAPADLRDKALRFAGEIIAFDPRVDSPEHGM
QIAAALLHEGKARAAFDRIAAAQGVRCDPVAPGTHTLVVPATTRGRVAGVDGLQISGVAR
AAGAPRDGGAGVDMLCAIGAKVAPGQPLYRIHSDSAEALEAAAALVRAGGECCQAVRIDP
D
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgaccggcacattcttctttgttgtggggcccagtggcgctggcaaggactcc
ctgatcgacggtgcacgtgccgcgctcgacggcgactacgtttttgcgcggcgcgtcatc
acgcgtcccgacgggtctgctggcgaagagcacgaaggtgtcacggaggccgagttcgcg
cggcgccagcgaagcggagagttcctggtgacctgggacgcgcacgacctgcgctacgga
ttgcccaagtccctgatgtgcgagctcgaacgcggccgcaacgtcgtggccaatggctcg
cgcggcgtcatcgcggaactcgcggcgcgcttgccccgtttcgtggtggtcctggtaacg
gcaccgcatgacgtgcttgcccggcgcattgccgcacgcgggcgggaatcgggcgaccag
gttgccagccgcgtggcacgcgcgggagctccggtgccgccacacgtcccgtgtatcacg
gtgtcgaaccacagcacgctggaagcaggcacggcacgctttgtcgaagccttgcgcacc
ggcaccaggacatccgccgccgaacggccggccagccgcaccaaccttatggccaagctg
cgcggcgagccgctcgacgaagcggcctacgttgccgtgctgcaggacgccatcgccggg
cgctacaccgaggccgagctgaccgagttcctggttgccgcaacccgcacgctcacggac
gaggaagtggtggctctggcgcgcgcgcgtaccgccttcacaccccgcatcgactgggac
gaaccggtagtcgtcgacaagcattcgatgggcggcgttcccggcagccgcatcacgctg
atcgtggtgccgatcgtcgcggcctacgggctggcgatgcccaagacatcgtcacgcgcg
atcacctctgccgccggcaccgccgatgccatggagaccatcgcacgggtcgacctggcg
catgaagacgtgcgccgatgcgtggcccaggcacgcgcctgcatcgcctggaacggacgg
ctgaaccattccgtggtcgacgatgtgatgaacgccatcacgcgaccgctgcggctcgat
tcgcggcgctggtcggtggcgtcgatcctgtcgaaaaagtacaccgccggcgccacccac
gtcattgtcgacctgccctacgggccgcaaaccaagctggcaacacgcgccgacgccgag
gcgctgggcgcgctgttcgaacacgtcggcaagggactgggcctgcacgtacgcgcactg
gtcacggacggcagcggcccgatcggccgcggcatcggccccgcactggaagtgcgcgac
gtccgactcgtgctcgacaacgctcccgatgcgcccgccgacctgcgcgacaaggccctg
cgctttgccggcgaaatcatcgcattcgatccccgcgtggactcccccgaacacggcatg
caaattgcggcggcgctgctgcatgaaggcaaggccagggccgcgttcgatcgcatcgcc
gccgcgcagggcgtccgctgcgatccagtggcgccgggtacgcatacgctggtcgttccc
gccaccacgcggggccgggtggcgggcgtcgatggcctgcagatttccggcgtggcgcgc
gccgccggcgcgccgcgcgatggcggtgccggggtcgacatgctgtgcgcgatcggtgca
aaggtggcgccagggcaaccgctctaccgtatccactcggactccgctgaagcgctagag
gcggctgcagcactggtgcgcgccggcggcgagtgctgccaggcggtgcgtatagacccc
gattga

DBGET integrated database retrieval system