KEGG   Ralstonia eutropha H16: H16_B0558Help
Entry
H16_B0558         CDS       T00416                                 

Gene name
h16_B0558
Definition
(GenBank) two domain protein: Guanylate kinase and thymidin phosphorylase domain
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00240  Pyrimidine metabolism
reh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    H16_B0558 (h16_B0558)
Enzymes [BR:reh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     H16_B0558 (h16_B0558)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C AAA_18 AAA_33 Glycos_trans_3N AAA_29 Guanylate_kin
Motif
Other DBs
NCBI-ProteinID: CAJ95355
UniProt: Q0K3R9
Position
2:complement(629052..630857)
Genome map
AA seq 601 aa AA seqDB search
MKATGTFFFVVGPSGAGKDSLIDGARAALDGDYVFARRVITRPDGSAGEEHEGVTEAEFA
RRQRSGEFLVTWDAHDLRYGLPKSLMCELERGRNVVANGSRGVIAELAARLPRFVVVLVT
APHDVLARRIAARGRESGDQVASRVARAGAPVPPHVPCITVSNHSTLEAGTARFVEALRT
GTRTSAAERPASRTNLMAKLRGEPLDEAAYVAVLQDAIAGRYTEAELTEFLVAATRTLTD
EEVVALARARTAFTPRIDWDEPVVVDKHSMGGVPGSRITLIVVPIVAAYGLAMPKTSSRA
ITSAAGTADAMETIARVDLAHEDVRRCVAQARACIAWNGRLNHSVVDDVMNAITRPLRLD
SRRWSVASILSKKYTAGATHVIVDLPYGPQTKLATRADAEALGALFEHVGKGLGLHVRAL
VTDGSGPIGRGIGPALEVRDVRLVLDNAPDAPADLRDKALRFAGEIIAFDPRVDSPEHGM
QIAAALLHEGKARAAFDRIAAAQGVRCDPVAPGTHTLVVPATTRGRVAGVDGLQISGVAR
AAGAPRDGGAGVDMLCAIGAKVAPGQPLYRIHSDSAEALEAAAALVRAGGECCQAVRIDP
D
NT seq 1806 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgaccggcacattcttctttgttgtggggcccagtggcgctggcaaggactcc
ctgatcgacggtgcacgtgccgcgctcgacggcgactacgtttttgcgcggcgcgtcatc
acgcgtcccgacgggtctgctggcgaagagcacgaaggtgtcacggaggccgagttcgcg
cggcgccagcgaagcggagagttcctggtgacctgggacgcgcacgacctgcgctacgga
ttgcccaagtccctgatgtgcgagctcgaacgcggccgcaacgtcgtggccaatggctcg
cgcggcgtcatcgcggaactcgcggcgcgcttgccccgtttcgtggtggtcctggtaacg
gcaccgcatgacgtgcttgcccggcgcattgccgcacgcgggcgggaatcgggcgaccag
gttgccagccgcgtggcacgcgcgggagctccggtgccgccacacgtcccgtgtatcacg
gtgtcgaaccacagcacgctggaagcaggcacggcacgctttgtcgaagccttgcgcacc
ggcaccaggacatccgccgccgaacggccggccagccgcaccaaccttatggccaagctg
cgcggcgagccgctcgacgaagcggcctacgttgccgtgctgcaggacgccatcgccggg
cgctacaccgaggccgagctgaccgagttcctggttgccgcaacccgcacgctcacggac
gaggaagtggtggctctggcgcgcgcgcgtaccgccttcacaccccgcatcgactgggac
gaaccggtagtcgtcgacaagcattcgatgggcggcgttcccggcagccgcatcacgctg
atcgtggtgccgatcgtcgcggcctacgggctggcgatgcccaagacatcgtcacgcgcg
atcacctctgccgccggcaccgccgatgccatggagaccatcgcacgggtcgacctggcg
catgaagacgtgcgccgatgcgtggcccaggcacgcgcctgcatcgcctggaacggacgg
ctgaaccattccgtggtcgacgatgtgatgaacgccatcacgcgaccgctgcggctcgat
tcgcggcgctggtcggtggcgtcgatcctgtcgaaaaagtacaccgccggcgccacccac
gtcattgtcgacctgccctacgggccgcaaaccaagctggcaacacgcgccgacgccgag
gcgctgggcgcgctgttcgaacacgtcggcaagggactgggcctgcacgtacgcgcactg
gtcacggacggcagcggcccgatcggccgcggcatcggccccgcactggaagtgcgcgac
gtccgactcgtgctcgacaacgctcccgatgcgcccgccgacctgcgcgacaaggccctg
cgctttgccggcgaaatcatcgcattcgatccccgcgtggactcccccgaacacggcatg
caaattgcggcggcgctgctgcatgaaggcaaggccagggccgcgttcgatcgcatcgcc
gccgcgcagggcgtccgctgcgatccagtggcgccgggtacgcatacgctggtcgttccc
gccaccacgcggggccgggtggcgggcgtcgatggcctgcagatttccggcgtggcgcgc
gccgccggcgcgccgcgcgatggcggtgccggggtcgacatgctgtgcgcgatcggtgca
aaggtggcgccagggcaaccgctctaccgtatccactcggactccgctgaagcgctagag
gcggctgcagcactggtgcgcgccggcggcgagtgctgccaggcggtgcgtatagacccc
gattga

DBGET integrated database retrieval system