KEGG   Ralstonia eutropha H16: H16_B0842Help
Entry
H16_B0842         CDS       T00416                                 

Gene name
phoD
Definition
phosphodiesterase/alkaline phosphatase D (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
reh  Ralstonia eutropha H16
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:reh00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:reh00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:reh02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(953849..955858)
Genome map
AA seq 669 aa AA seqDB search
MDRRQFLKWGSFLTVTVATGGLSACGGGDDPEPDTGNPENFNFVHGVASGDPKPDSVVVW
TRLEGSNGKRPVVVRLQVSAQPDFPPPSLLVNQPLMALPDWDYTIRNKVTGLSPGTRYYY
RFLLGNRPSTVGRTRTAAAAGTPLSQLRFAFVSCQDWNANHWAGMEELAQQDLDFIVHVG
DYIYEAVPGGSRAGNVEDRHGVLQLPNGTALPDGSVYATTLDDYRYLYRSYRTDARLQAL
HAAFPMIAIWDDHEFSDNCWQDRQTYDSDDDLTPRTARRRAANQAWFEFMPADVSLDVNN
PSFQNIQIYRSFTFGNLATLLMTDERLYRADHIISEQATGRAVGALYFVPAETLAAAEAQ
KIAAAGGTLTPVSMLGDAQRAWWQDRVGADATAWKLWANQLSLLRMQVDVIQAVARLIAR
ALVLANNSLSSLESAIANALADDLRAAKTAGTYANLAYTALRNVLAQVGIDSATFDANIK
PLIESRLPAIALLDRFILNADQWDGYNAERKNLMAFLKNNGVRNVVALSGDIHAFFAGQV
MDDYDAATPAPVMVDLVTAGLSSNSLLSSFRSIVDNDQAFAALRELVYSDVGSTVVNTFD
TTLRTFNAWLRHADSNAEGYTLVTLTPEKLSCTFHTLKPLEGGTAPALPATASTRLLEVA
AGTADVSVT
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggaccgccgacagtttctcaagtggggaagtttcctgaccgtcaccgttgccaccggc
gggctgagcgcctgcggcggcggcgacgacccggaacccgacaccggcaatccggaaaat
ttcaatttcgtccatggcgtcgcctcgggcgaccccaagcccgacagcgtggtggtatgg
acgcggctggaaggcagcaatggcaagcggccggtggtggtgcggctgcaggtgtcggcg
cagcctgacttcccgccgccgagcctgctggtcaatcaaccgctgatggccctgccggac
tgggactacaccatccgcaacaaggtcacgggcctgagccccggcacccgctactactac
cgcttcctgctgggcaaccgccccagcaccgtcggccgcacccgcaccgcggcagcggcc
ggcacgcccttgtcacagctgcgtttcgcctttgtcagctgccaggactggaatgccaac
cactgggccggcatggaagaactggcgcagcaggacctggacttcatcgtccatgtcggc
gactacatctacgaggccgtcccgggcggctcgcgcgccggcaatgtggaggatcgccac
ggcgtgctgcaactgcccaatggcaccgcgctgccggacggcagcgtctacgccaccacg
ctggacgactatcgctacctgtaccgcagctatcgcaccgacgcgcgcctgcaggccctg
catgccgcgttcccgatgattgcgatctgggacgaccatgaattctcggacaattgctgg
caggaccggcagacctacgactccgacgacgacctgacgccgcgcaccgcgcgccggcgc
gctgccaaccaggcgtggttcgagttcatgccggccgatgtcagcctggacgtcaacaac
ccgtcgttccagaacatccagatctatcgctcgttcaccttcggcaatctcgccaccctg
ctgatgaccgacgagcgcctgtaccgcgccgaccacatcatctccgagcaagccaccggc
cgcgcagtcggcgccctgtacttcgtcccggccgagacactggctgcggccgaagcgcag
aagattgccgccgccggcggcacgctgacaccggtgtcgatgctgggcgatgcgcagcgc
gcgtggtggcaggaccgcgtcggcgccgacgccaccgcgtggaagctgtgggccaaccag
ttgtcgctgttgcgcatgcaggtggatgtgatccaggcggtggcacggctgatcgccagg
gcgctggtgctggccaacaattccctgtcctcgctggagagcgccattgccaatgcgctg
gccgacgacctgcgcgcggccaagaccgccggcacctatgccaacctggcctacacggcg
ctgcgcaatgtactggcgcaggtcggcatcgacagcgccacgttcgatgccaacatcaag
ccgctgatcgaaagccggttgccggccatcgcgctgctcgaccgctttatcctcaatgcc
gaccagtgggatggctacaacgccgagcgcaagaacctgatggcgttcctgaagaacaac
ggcgtgcgcaatgtggtggcgctgagcggcgatatccacgcattctttgccggccaggtg
atggacgactacgatgcggcgacgccagcgccggtgatggtggacctggtcacggccggc
ctgtcgagcaactccctgctcagttcattccgctcgatcgtcgacaacgaccaggccttc
gccgcactgcgtgaactggtctacagcgacgtgggcagcacggtggtgaacaccttcgac
accaccttgcgcaccttcaacgcgtggctgcgccatgccgactccaacgccgagggctac
acgctggtcaccctgacgcccgagaagctgagctgcaccttccatacgctcaagccgctc
gagggcggcacggcgccggcgctacctgccacggcgagcacgcggctgctggaggtggcg
gcgggaaccgcggatgtaagcgtgacatag

DBGET integrated database retrieval system