KEGG   Cupriavidus necator H16: H16_B0939Help
Entry
H16_B0939         CDS       T00416                                 

Gene name
cyp
Definition
monooxygenase / flavin reductase (EC:1.14.14.1)
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
reh  Cupriavidus necator H16
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    H16_B0939 (cyp)
  Amino acid metabolism
   00380 Tryptophan metabolism
    H16_B0939 (cyp)
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    H16_B0939 (cyp)
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     H16_B0939 (cyp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1059693..1060256
Genome map
AA seq 187 aa AA seqDB search
MIPALAPLPYDTQACNDSGQDDPARAISHDGAARRALRDALGQFATGVTIVTAADADGQP
VGVTINAFTSVSLAPPLLLWCLARSSGSLAALRAAPCHAINVLGSGQQALCRRFAARGAD
RFAGVDCRPGPFGTVLSGGTLAYFICRHHSVRVVGDHVIFVVEVVAYGSTPGAPLVFHAG
GFEVPAP
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgatccccgccctggcgccgctgccgtatgacacgcaagcctgcaacgacagcggccag
gacgacccggcccgcgccatcagccacgatggcgcggcgcggcgggccttgcgcgatgcg
ctggggcagtttgccacgggcgttaccatcgtcacggccgcggacgccgacggccagccg
gtcggcgtcacgatcaatgcctttacctcggtgtcgctcgcaccgccgttgctgttgtgg
tgcctggcacgcagctccggcagcctggcggcgctgcgtgcggcgccgtgccacgcgatc
aatgtgctggggagcgggcagcaggccttgtgccggcgcttcgccgcgcgcggtgctgac
cgcttcgcgggcgtcgattgccgccccgggccgtttggcacggtgctgagcggcggcacg
ctggcgtactttatctgccggcaccactcggtgcgcgtggtgggcgaccacgtgatcttt
gtcgtggaggtggtggcctatggatcgacgccgggcgcgccgctggtgttccacgcaggc
gggtttgaggtaccagcgccttag

DBGET integrated database retrieval system