KEGG   Ralstonia eutropha H16: H16_B1009Help
Entry
H16_B1009         CDS       T00416                                 

Definition
bifunctional P-450:NADPH-P450 reductase (EC:1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
reh  Ralstonia eutropha H16
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:reh00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:reh00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:reh00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1133531..1136818)
Genome map
AA seq 1095 aa AA seqDB search
MPPPIELSSPDQASDAPHQAPARSMHAPIPEPIPRDPGWPLVGNLLQITPGALGQHLLAR
SRHHDGIFELNFAGRRVPFVTSVALASELCDAAQFRKYIGPPVSYLRGMAGDGLFTARSD
EANWGKAHRILMPAFSQRAMKGYFDVMLRVANRLVDKWDQQGPDADIAVADDMTRLTLDT
IALSGFGYDFESFASTELHPFIEAMVGALEEAMSKLTRFALQDRFMHAAHQKFDQDTRFM
RDLVDDVIRRRRAGDAAERPGGTANDLLGLMLEARDPDTDQRLDDENIRNQVITFLIAGH
ETTSGLLTFALYELLRNPGVMAQAYAEVDAVLPGDAAPVYADLARLPVLDRVLKETLRLW
PTAPAFAVAPFEDTLLGGRYLIRKDRRLSVVLTALHRDPKVWADPERFDIDRFLPEQEAK
LPRHAYMPFGNGERACIGRQFALTEAKLALALMLRNFQFTDAHDYQFRIKETLTIKPDGF
TVRARRRRPHERIAAAPLAGTAQAPRAGPDVQGRGRTLAVLCGSSLGTARELAEQVHAGA
LAAGFDATLRDLDDVADALPTTGLAVIIAATYNGRAPDSARRLEALLDSGAASGYRAEAL
SVAVLGCGNSQWPTYQAFPRRVYEFFTNAGASPLLPRGEADGNGDFDQAVERWLALLWQA
LQAGDGVGGPAHGTPPVRVQVKDVAEIRASTLPANTEAFTVLANTELVNDPSGLWDFSHE
APRTSTRDIRLRLPDGVRYATGDHLAVYPQNQPGMVAALCERIGIDPDAIVTLSASGGAA
RGLPLGEALSVRQLLTHFVELQDVVSRHTLRLLSQSSRCPVTRQALRQLASDDAGSGYAA
QVAPRRLGLADVLDRFPAIEVDLAGLLACTVPMRPRFYSIASSPLVSPGVATITVGTVWS
PALSGRGLFRGVASTWLQGLAPGAMVAGAIRTPNPTFAPAADPATPMILIGPGTGIAPFR
GFLEERAAQQAAGQPVAPVQLYYGCRHPAHDWLYRNNVERWQAQGVVQVHLACSVVDGEP
RYVQDLLWQRRADVWARLNQGAIIYVCGDGRHMAPAVRQVLIQIGAEQGGMTPEAASDWL
ADLVSAGRYRQDVFN
NT seq 3288 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgcccattgagctatccagccccgaccaggcctccgacgcgccgcatcaagcc
cctgcccgctccatgcatgcccccatccccgagcccatcccgcgcgacccgggttggccg
ctggtcggcaacctgctgcagatcacacccggtgcgctgggccagcacctgctggcgcgc
agccgccaccatgatggcatcttcgaactgaatttcgccggccggcgcgtgccgttcgtg
acgtcggtggcactggcctccgagttgtgcgatgccgcgcagttccgcaagtacatcggc
ccgccggtgtcctacctgcgcggcatggccggcgacgggctgttcaccgcacgctccgac
gaggccaactggggcaaggcgcaccgcatcctgatgccggcgttcagccagcgcgcgatg
aagggctacttcgacgtcatgctgcgcgtggccaaccggctggtggacaaatgggaccag
caaggcccggatgccgatatcgcggtcgctgacgacatgacgcggctgacgctcgatacc
atcgcgctgtccggcttcggctatgactttgaatcgttcgccagcacggaactgcacccc
ttcatcgaggccatggtgggcgcgctggaagaggcgatgtccaagctgacgcgctttgcc
ctgcaagaccgcttcatgcatgcggcgcaccagaagttcgaccaggacacccgcttcatg
cgcgaccttgtggacgacgtgatccggcggcggcgcgcgggcgacgcggcggaacgcccg
ggcggcacggccaacgacctgctcggcctgatgctggaagcgcgggatccggacaccgac
cagcggctggacgacgagaacatccgcaaccaggtgatcacgttcctgattgcgggccac
gagaccaccagcggcctgctcaccttcgcgctgtatgaactgctgcgcaacccgggcgtg
atggcacaggcctacgcggaggtggacgccgtgctgcccggcgacgcggcgccggtctac
gccgacctggcgcggctgccggtactggaccgcgtgctgaaggaaacgttgcgcctgtgg
cccaccgcgcctgccttcgccgtggcgccgtttgaagacacgctgctgggcggccgctac
ctgatccgcaaggacaggcgcctgtcggtggtgctgaccgcgctgcaccgcgaccccaag
gtgtgggccgacccggaacgctttgacatcgatcgcttcctgcctgagcaggaggcaaag
ctgccgcgccacgcctacatgcctttcggcaacggggaacgtgcctgcatcggccgccag
tttgcgctgaccgaggccaagctggcactggcgctgatgttgcgcaatttccagttcacc
gacgcgcacgactaccagttccgcatcaaggaaacactgacgatcaagcccgacggattc
acggtgcgtgcgcgccggcgccggccgcatgagcgcatcgctgcggcgccgctcgccggg
accgcgcaagcgccgcgggcgggccccgatgtgcagggccgcggcaggacacttgccgtg
ctgtgcggatccagccttggcaccgcgcgcgaactggctgagcaggtgcatgccggcgcg
ctggcggcgggctttgatgcgacgctgcgcgacctggacgacgtggccgacgcgctcccg
accaccggcctggccgtcatcatcgccgccacctataacggccgcgcgccggactcggca
aggcggctcgaagcgctgctcgacagcggcgccgccagcggctaccgggcagaagcgctg
agcgtggccgtgctgggctgcggcaactcgcaatggccgacgtaccaggccttcccgcgc
cgcgtctatgaattcttcaccaatgccggcgccagtccgctgctgccgcgtggcgaagcc
gacggcaacggcgacttcgaccaggccgtggaacggtggctggccttgctgtggcaagcc
ttgcaggccggtgacggcgtgggcgggccggcccacgggacgccgccggtccgggtgcag
gtgaaagacgtcgccgagatccgcgcgtccacgctgccggcaaacaccgaggccttcacg
gtcctggccaacaccgagctggtgaacgatccgtccggcctgtgggatttctcgcacgag
gcgccgcggacttccacgcgcgatatccgcctcaggctgcccgacggcgtgcgctacgcc
acaggcgatcacctcgccgtctatccgcagaaccagcccgggatggtcgcggccctgtgc
gagcggatcggcatcgacccggacgcaatcgtcacgttgtccgcctccggcggggccgcg
cgcggcctgccgctgggcgaggccctgtccgtgcgccagttgctgacccattttgtggag
ctgcaggacgtggtgtcgcgccataccctgcgcctgctgtcgcagtcttcgcgctgcccg
gtcacgcgccaggccctgcggcagctggcctcggacgacgccgggagcgggtacgccgcc
caggtggcgccgcgccggctcgggctggccgacgtgctggaccgctttcccgccatcgag
gtggatctggccggcctgctggcttgcaccgtgccaatgcggccgaggttctattcgatc
gcctcatcgccgctggtctcgcccggcgtggcgaccatcaccgtcggcacggtctggtca
ccggcgctatcgggccgcggactcttccgcggcgtggcttccacctggctgcagggcctg
gcgccaggcgccatggtggcgggtgccatccgcacccccaatcccaccttcgcgcccgcg
gcggacccggccacgcccatgatcctgatcggccccggcacgggcattgcgccgttccgc
ggctttcttgaggagcgggccgcgcaacaggcagccgggcagccggtggccccggtgcag
ctgtactacggctgccgccaccccgcgcacgactggctctaccgcaacaacgtggagcgc
tggcaggcacagggcgtggtgcaggtccacctggcctgttcagtcgtggatggcgagccg
cgctacgtgcaggacctgctgtggcagcgccgtgccgatgtctgggcccggctgaaccag
ggcgcgatcatctacgtgtgcggcgacggccgccacatggcgcccgcggtcaggcaggtg
ctgattcagatcggcgcagagcaaggggggatgacgccagaggcggcttcggactggctg
gcggacctagtcagcgcgggacgctatcggcaggacgtgttcaactga

DBGET integrated database retrieval system