KEGG   Ralstonia eutropha H16: H16_B1009Help
Entry
H16_B1009         CDS       T00416                                 

Definition
bifunctional P-450:NADPH-P450 reductase (EC:1.6.2.4)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
reh  Ralstonia eutropha H16
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    H16_B1009
  Amino acid metabolism
   00380 Tryptophan metabolism
    H16_B1009
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    H16_B1009
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     H16_B1009
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     H16_B1009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1133531..1136818)
Genome map
AA seq 1095 aa AA seqDB search
MPPPIELSSPDQASDAPHQAPARSMHAPIPEPIPRDPGWPLVGNLLQITPGALGQHLLAR
SRHHDGIFELNFAGRRVPFVTSVALASELCDAAQFRKYIGPPVSYLRGMAGDGLFTARSD
EANWGKAHRILMPAFSQRAMKGYFDVMLRVANRLVDKWDQQGPDADIAVADDMTRLTLDT
IALSGFGYDFESFASTELHPFIEAMVGALEEAMSKLTRFALQDRFMHAAHQKFDQDTRFM
RDLVDDVIRRRRAGDAAERPGGTANDLLGLMLEARDPDTDQRLDDENIRNQVITFLIAGH
ETTSGLLTFALYELLRNPGVMAQAYAEVDAVLPGDAAPVYADLARLPVLDRVLKETLRLW
PTAPAFAVAPFEDTLLGGRYLIRKDRRLSVVLTALHRDPKVWADPERFDIDRFLPEQEAK
LPRHAYMPFGNGERACIGRQFALTEAKLALALMLRNFQFTDAHDYQFRIKETLTIKPDGF
TVRARRRRPHERIAAAPLAGTAQAPRAGPDVQGRGRTLAVLCGSSLGTARELAEQVHAGA
LAAGFDATLRDLDDVADALPTTGLAVIIAATYNGRAPDSARRLEALLDSGAASGYRAEAL
SVAVLGCGNSQWPTYQAFPRRVYEFFTNAGASPLLPRGEADGNGDFDQAVERWLALLWQA
LQAGDGVGGPAHGTPPVRVQVKDVAEIRASTLPANTEAFTVLANTELVNDPSGLWDFSHE
APRTSTRDIRLRLPDGVRYATGDHLAVYPQNQPGMVAALCERIGIDPDAIVTLSASGGAA
RGLPLGEALSVRQLLTHFVELQDVVSRHTLRLLSQSSRCPVTRQALRQLASDDAGSGYAA
QVAPRRLGLADVLDRFPAIEVDLAGLLACTVPMRPRFYSIASSPLVSPGVATITVGTVWS
PALSGRGLFRGVASTWLQGLAPGAMVAGAIRTPNPTFAPAADPATPMILIGPGTGIAPFR
GFLEERAAQQAAGQPVAPVQLYYGCRHPAHDWLYRNNVERWQAQGVVQVHLACSVVDGEP
RYVQDLLWQRRADVWARLNQGAIIYVCGDGRHMAPAVRQVLIQIGAEQGGMTPEAASDWL
ADLVSAGRYRQDVFN
NT seq 3288 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgcccattgagctatccagccccgaccaggcctccgacgcgccgcatcaagcc
cctgcccgctccatgcatgcccccatccccgagcccatcccgcgcgacccgggttggccg
ctggtcggcaacctgctgcagatcacacccggtgcgctgggccagcacctgctggcgcgc
agccgccaccatgatggcatcttcgaactgaatttcgccggccggcgcgtgccgttcgtg
acgtcggtggcactggcctccgagttgtgcgatgccgcgcagttccgcaagtacatcggc
ccgccggtgtcctacctgcgcggcatggccggcgacgggctgttcaccgcacgctccgac
gaggccaactggggcaaggcgcaccgcatcctgatgccggcgttcagccagcgcgcgatg
aagggctacttcgacgtcatgctgcgcgtggccaaccggctggtggacaaatgggaccag
caaggcccggatgccgatatcgcggtcgctgacgacatgacgcggctgacgctcgatacc
atcgcgctgtccggcttcggctatgactttgaatcgttcgccagcacggaactgcacccc
ttcatcgaggccatggtgggcgcgctggaagaggcgatgtccaagctgacgcgctttgcc
ctgcaagaccgcttcatgcatgcggcgcaccagaagttcgaccaggacacccgcttcatg
cgcgaccttgtggacgacgtgatccggcggcggcgcgcgggcgacgcggcggaacgcccg
ggcggcacggccaacgacctgctcggcctgatgctggaagcgcgggatccggacaccgac
cagcggctggacgacgagaacatccgcaaccaggtgatcacgttcctgattgcgggccac
gagaccaccagcggcctgctcaccttcgcgctgtatgaactgctgcgcaacccgggcgtg
atggcacaggcctacgcggaggtggacgccgtgctgcccggcgacgcggcgccggtctac
gccgacctggcgcggctgccggtactggaccgcgtgctgaaggaaacgttgcgcctgtgg
cccaccgcgcctgccttcgccgtggcgccgtttgaagacacgctgctgggcggccgctac
ctgatccgcaaggacaggcgcctgtcggtggtgctgaccgcgctgcaccgcgaccccaag
gtgtgggccgacccggaacgctttgacatcgatcgcttcctgcctgagcaggaggcaaag
ctgccgcgccacgcctacatgcctttcggcaacggggaacgtgcctgcatcggccgccag
tttgcgctgaccgaggccaagctggcactggcgctgatgttgcgcaatttccagttcacc
gacgcgcacgactaccagttccgcatcaaggaaacactgacgatcaagcccgacggattc
acggtgcgtgcgcgccggcgccggccgcatgagcgcatcgctgcggcgccgctcgccggg
accgcgcaagcgccgcgggcgggccccgatgtgcagggccgcggcaggacacttgccgtg
ctgtgcggatccagccttggcaccgcgcgcgaactggctgagcaggtgcatgccggcgcg
ctggcggcgggctttgatgcgacgctgcgcgacctggacgacgtggccgacgcgctcccg
accaccggcctggccgtcatcatcgccgccacctataacggccgcgcgccggactcggca
aggcggctcgaagcgctgctcgacagcggcgccgccagcggctaccgggcagaagcgctg
agcgtggccgtgctgggctgcggcaactcgcaatggccgacgtaccaggccttcccgcgc
cgcgtctatgaattcttcaccaatgccggcgccagtccgctgctgccgcgtggcgaagcc
gacggcaacggcgacttcgaccaggccgtggaacggtggctggccttgctgtggcaagcc
ttgcaggccggtgacggcgtgggcgggccggcccacgggacgccgccggtccgggtgcag
gtgaaagacgtcgccgagatccgcgcgtccacgctgccggcaaacaccgaggccttcacg
gtcctggccaacaccgagctggtgaacgatccgtccggcctgtgggatttctcgcacgag
gcgccgcggacttccacgcgcgatatccgcctcaggctgcccgacggcgtgcgctacgcc
acaggcgatcacctcgccgtctatccgcagaaccagcccgggatggtcgcggccctgtgc
gagcggatcggcatcgacccggacgcaatcgtcacgttgtccgcctccggcggggccgcg
cgcggcctgccgctgggcgaggccctgtccgtgcgccagttgctgacccattttgtggag
ctgcaggacgtggtgtcgcgccataccctgcgcctgctgtcgcagtcttcgcgctgcccg
gtcacgcgccaggccctgcggcagctggcctcggacgacgccgggagcgggtacgccgcc
caggtggcgccgcgccggctcgggctggccgacgtgctggaccgctttcccgccatcgag
gtggatctggccggcctgctggcttgcaccgtgccaatgcggccgaggttctattcgatc
gcctcatcgccgctggtctcgcccggcgtggcgaccatcaccgtcggcacggtctggtca
ccggcgctatcgggccgcggactcttccgcggcgtggcttccacctggctgcagggcctg
gcgccaggcgccatggtggcgggtgccatccgcacccccaatcccaccttcgcgcccgcg
gcggacccggccacgcccatgatcctgatcggccccggcacgggcattgcgccgttccgc
ggctttcttgaggagcgggccgcgcaacaggcagccgggcagccggtggccccggtgcag
ctgtactacggctgccgccaccccgcgcacgactggctctaccgcaacaacgtggagcgc
tggcaggcacagggcgtggtgcaggtccacctggcctgttcagtcgtggatggcgagccg
cgctacgtgcaggacctgctgtggcagcgccgtgccgatgtctgggcccggctgaaccag
ggcgcgatcatctacgtgtgcggcgacggccgccacatggcgcccgcggtcaggcaggtg
ctgattcagatcggcgcagagcaaggggggatgacgccagaggcggcttcggactggctg
gcggacctagtcagcgcgggacgctatcggcaggacgtgttcaactga

DBGET integrated database retrieval system