KEGG   Ralstonia eutropha H16: H16_B1102Help
Entry
H16_B1102         CDS       T00416                                 

Gene name
h16_B1102
Definition
(GenBank) Acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00010  Glycolysis / Gluconeogenesis
reh00620  Pyruvate metabolism
reh00640  Propanoate metabolism
reh00680  Methane metabolism
reh01100  Metabolic pathways
reh01110  Biosynthesis of secondary metabolites
reh01120  Microbial metabolism in diverse environments
reh01130  Biosynthesis of antibiotics
reh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H16_B1102 (h16_B1102)
   00620 Pyruvate metabolism
    H16_B1102 (h16_B1102)
   00640 Propanoate metabolism
    H16_B1102 (h16_B1102)
  Energy metabolism
   00680 Methane metabolism
    H16_B1102 (h16_B1102)
Enzymes [BR:reh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     H16_B1102 (h16_B1102)
Lipid biosynthesis proteins [BR:reh01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   H16_B1102 (h16_B1102)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: CAJ95893
UniProt: Q0K281
Position
2:1247611..1249263
Genome map
AA seq 550 aa AA seqDB search
MRDYAQAFDGFSYDDAVARQLHGSQEAMNACVECCDRHALPGRIALFWEGRDGNSRSWTF
TELQALSAQFAGFLKAQGVQPGDRVAGLLPRNAELLVTILGTWRAGAVYQPLFTAFGPKA
IEHRLNASGAKVVVTDGANRPKLDDVDGCPAIVTVAGDKGRGLVRGDFSFWAELERQPAS
FEPVPRRGDDPFLMMFTSGTTGPAKPLLVPLKAIAAFAGYMSDAVDLRAEDAFWNLADPG
WAYGLYYAVTGPLALGHPTTFYDGPFTVESTCRVIRKYGITNLAGSPTAYRLLIAAGEAV
SGPLRGRLRAVSSAGEPLNPEVIRWFASELGVTIHDHYGQTELGMVLCNHHALAHPVRMG
AAGFASPGHRVVVVDDEQRELPPGRPGTLALDLKRSPMCWFGGYHGTPTSGFAGGYYLTG
DSAELNDDGSISFIGRADDVITTSGYRVGPFDVESALIEHPAVVEAAVIGKPDPERTELI
KAFVVLDPQYRAAPELAEALRQHVRKRLAAHAYPREIEFVVELPKTPSGKVQRFILRNQE
VARAREAAAA
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgactacgcccaagccttcgacggattttcctatgacgacgccgtggcacggcaa
ctgcacggcagccaggaggcaatgaacgcctgcgtcgaatgctgcgaccgccacgcgctg
ccgggccgtatcgcgctgttctgggaagggcgagacggcaattcgcgcagctggaccttt
accgagctgcaggcactgtccgcgcagtttgccggcttcctgaaggcgcagggcgtgcag
ccgggcgaccgcgtggcgggcctgctgccgcgcaatgcggaactgctggtgacgattctc
ggcacctggcgcgccggcgcggtgtaccagccgctgttcacggccttcggccccaaggcc
atcgagcaccggctcaatgcgtccggcgcgaaggttgtggtcaccgatggcgccaaccgc
cccaagctggatgacgtggatggctgtcccgccattgtcaccgtggccggcgacaagggc
cgcggcctggtgcgcggcgacttcagcttctgggccgaactggaacgccagccggcgtcg
ttcgagccggtgccgcgccggggcgacgaccccttcctgatgatgttcacctccggcacc
accggcccggccaagccgctgctggtgccgctcaaggccattgccgcgtttgccggctat
atgagcgacgcggtcgacctgcgcgcggaagacgctttctggaacctggccgatccgggc
tgggcctatggcctgtattacgcggtcacgggcccgctggcgctgggccatcccaccacc
ttctacgatggcccgttcaccgtggagagcacatgccgtgtgatccgcaagtacggcatc
accaacctggccggctcgcccacggcataccggctgctgatcgccgcgggcgaggccgtg
tcaggcccgctgcgcgggcggctgcgcgcggtcagcagcgcgggcgagccgctcaacccg
gaagtgatccgctggttcgccagcgagctgggcgtgaccatccacgaccactacggccag
accgagctgggcatggtgctgtgcaaccaccatgcgctggcgcatccggtgcgcatgggc
gcggccggctttgccagccccgggcaccgcgtggtggtggtggacgatgaacagcgcgaa
ctgccgccgggccggccgggcacgctggcgctggacctgaagcgctcgccgatgtgctgg
ttcggcggctatcacggcacgcccaccagcgggtttgccggcggctactacctgaccggc
gattccgccgagctgaatgacgacggcagcatcagcttcataggccgggccgacgacgtc
atcaccacctctggctaccgcgtgggcccgttcgacgtggaaagcgcgctgatcgagcac
ccggccgtggtcgaggccgcggtgatcggcaagcccgatccggagcgcaccgagctgatc
aaggcctttgtcgtgctggacccgcaatatcgcgccgcgccggaactggccgaggcgctg
cgccagcacgtgcgtaagcgcctggccgcccatgcctacccgcgcgagatcgagttcgtc
gtcgagctgcccaagacccccagcggcaaggtccagcgctttatcctgcgcaaccaggaa
gtggcccgcgcgcgcgaggcggccgctgcctga

DBGET integrated database retrieval system