KEGG   Ralstonia eutropha H16: H16_B1313Help
Entry
H16_B1313         CDS       T00416                                 

Gene name
h16_B1313
Definition
(GenBank) Muramidase (phage lysozyme)
  KO
K01185  
lysozyme [EC:3.2.1.17]
Organism
reh  Ralstonia eutropha H16
Brite
Enzymes [BR:reh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     H16_B1313 (h16_B1313)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:complement(1466094..1466729)
Genome map
AA seq 211 aa AA seqDB search
MTRYEFALLALAAVGYVVWRDWQRSEEPGAQSPDFIDQAENLFYDATEGNFFGGTEDTDM
GQAQLNRAAFLLTIRTGEGTAGNDGYRMLFGGGKFDSFADHPRQVVTALSNGKPISSSAA
GAYQFLRRTWDTLAARLGLTDFSPASQDAAALELIREAGALGDVDAGRFALAVRKVRKIW
ASMPGAGYGQPEVALERLQAAYQAAGGVVNG
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgctacgagttcgcgctgctggccttggccgccgtgggctacgtggtgtggcgc
gactggcagcgcagcgaagagccgggcgcgcagtcgccggacttcatcgaccaggccgaa
aacctgttttacgacgccaccgaaggcaacttcttcggcggcactgaggacaccgacatg
gggcaagcacaactgaatcgcgccgccttcctgctgacgattcgcaccggggagggcacc
gcaggcaatgacggataccgcatgctgttcggcggcgggaagttcgattccttcgcggat
catccgcgccaggtggtgaccgccctgtcgaacggcaagccgatcagcagcagcgcggca
ggcgcctaccagttcctgcgccgcacgtgggacacgctggccgcccggctgggcctgacg
gacttctcgccggccagccaggacgcggcggcgctggaactgatccgcgaagcgggcgcc
ctgggtgacgtggacgcgggccgcttcgcgctggcggtgcgcaaggtgcgcaagatttgg
gcgtccatgcccggcgccgggtacggccagccggaagtggcgctggaacgattgcaggcc
gcatatcaagcggcagggggtgtagtgaatggctaa

DBGET integrated database retrieval system