KEGG   Ralstonia eutropha H16: H16_B1433Help
Entry
H16_B1433         CDS       T00416                                 

Gene name
adhP
Definition
(GenBank) alcohol dehydrogenase, Zn-dependent
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00010  Glycolysis / Gluconeogenesis
reh00071  Fatty acid degradation
reh00350  Tyrosine metabolism
reh00625  Chloroalkane and chloroalkene degradation
reh00626  Naphthalene degradation
reh01100  Metabolic pathways
reh01110  Biosynthesis of secondary metabolites
reh01120  Microbial metabolism in diverse environments
reh01130  Biosynthesis of antibiotics
reh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H16_B1433 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    H16_B1433 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    H16_B1433 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    H16_B1433 (adhP)
   00626 Naphthalene degradation
    H16_B1433 (adhP)
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     H16_B1433 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N_2 ADH_zinc_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: CAJ96221
UniProt: Q0K1A3
Position
2:1604142..1605155
Genome map
AA seq 337 aa AA seqDB search
MPHQTMRAMVFEGAGLPLRLHHLPVAEPGPGELRIAVGACGVCRTDLHIADGDLRHPKPV
LIPGHEIVGQVDSCGAGVTVFKPGDRVGVPWLGHSCGHCRYCLRHHENLCDAPLFTGYTR
DGGYAEYVVADSGYCFRIPPGYDDEHAAPLLCAGLIGYRTLRMAGAASHAQRVGIYGFGA
AAHLVTQIAVAQGREVYAFTRTGDAGAQQLAYQSGACWAGSSELESPVPLDAALIFAPVG
ALVPKALRAVDKGGIVVCGGIHMSDIPSMPYQLLWEERRLCSVANLTRADGIALMDIAAR
TPLHTHTTAYPLEQANEALADLREGRLTGAAVLKVRQ
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgccccaccaaaccatgcgtgcaatggtcttcgagggcgcaggcctgccgctgcgcctc
caccacttgccggttgccgaaccggggcccggcgaacttcgcattgccgtgggagcttgc
ggggtgtgccggaccgacctgcatatcgccgacggcgacctgcgccatcccaagccggtg
ctcatcccgggacatgaaatcgtcggacaggtggattcgtgcggcgccggtgtcaccgtc
ttcaagccgggggaccgcgtcggtgtgccctggctcggacatagctgtggccattgtcgc
tactgcctgcgtcatcacgagaatctttgcgacgcaccgctgttcactggctatacccgc
gatggcggctatgcggagtacgttgttgccgacagcggctattgcttccggattccgccc
ggctacgatgacgaacacgccgcgccactactctgcgcgggcctgatcggctaccggacg
ctgcgcatggcgggcgcagccagccatgcgcagcgcgtcggcatctacggcttcggcgcc
gccgcccacctggtgacgcagatcgcggtggcgcaaggccgcgaagtctacgccttcacc
cgcacgggcgacgcaggcgcccagcaactcgcctaccaatccggtgcgtgctgggccggc
tcgagcgagctcgagtcgcccgtgccgctggacgccgcgctgattttcgccccggtgggc
gcgctggtgcccaaggcgctgcgcgccgtggacaagggtggcatcgtggtctgtggcgga
attcatatgagcgatatcccaagcatgccttaccagctgctttgggaagaaaggcgcctg
tgttccgtagccaacctcacgcgtgccgacggcatcgcgctgatggatatcgccgcccgg
acgccgctgcatacgcacaccaccgcgtatccgctggagcaggccaacgaagcactggcc
gacctgcgcgagggccggcttaccggcgccgccgtcctgaaagtccgtcaatag

DBGET integrated database retrieval system