KEGG   Cupriavidus necator H16: H16_B1561Help
Entry
H16_B1561         CDS       T00416                                 

Gene name
malQ
Definition
4-Alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
reh  Cupriavidus necator H16
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    H16_B1561 (malQ)
Enzymes [BR:reh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     H16_B1561 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1756419..1758668
Genome map
AA seq 749 aa AA seqDB search
MSRRATRHDTPTALHALALRAGLLPRWTDAWNQPQTVSDAALRRVLDGLGLPCATTGQCE
ASRAWLASDDAAHALPPLVTAERGKPVAVPWPHTLPQRSYRLTLEDGAIVTGTAERGNDG
SARDSDGTMLLPAIDVCGYHRLELGDAHTVLAIAPPRCYGVADALRHAGRAGELTRPWGL
AVQLYGLRRGAPCGLGDLSALTQCCISAAGASADAVAINPLHAGFAALPERYSPYAPSSR
LFLNPLYADPAVQFGQAAVDWAVAALGAGESLQALEARSEIDWVKLTPLRYAILRWLWER
SDALLPRAALDDCAAFRARGGTALHAHACYEAIQARRLADSANGMNHNPAPDWRCWPVTL
RAPGDAAVAAFAQAHANEVAYHAFLQWITADGMARAQRAARGAGMAVGIVSDLAVGADPG
GSQAWTRQQEILAGFHAGAPPDLYNPLGQDWGVAVFSPRGLRRRGYAAFLEMLRANLAHA
GGLRIDHVLGLARMWLVPAGAPASEGAYLRYPLQDMLRLVALESWRHRAIIIGENLGTVP
PELNAALSARGVLGIDVLWFQREESAPVDAAEAAQRVPAPAPDTVPAFLPPAAWPPDAIA
TTSTHDLPTVTGWWAGRDLAWRDRLHLLAPGETLAAMQAGRARERGALWQALCAAGLCSG
AVPDPADAPLDAVLAWLGTARTAMRLVPLEDLLGEAEQPNLPGTTSVHPNWQRRLDADVR
ALFDTPMVRARANALRGGRHGARHPPPRA
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcgcgccacccgccacgacacgcccacggcgctgcatgcgctggcactgcgc
gcgggcctgctgccccggtggacggatgcctggaaccagccccagaccgtgtcggacgcc
gcactgcggcgcgtcctggacggcctgggcctgccttgcgccaccactggccagtgcgaa
gcgtcgcgcgcatggcttgcctccgatgacgccgcgcatgcactgccgccgctggtcacc
gccgagcgcggcaagccggtggcggtgccgtggccacataccctgccgcagcggtcctac
cggctgacgctggaagacggcgccatcgtcaccggcaccgcggagcgtggcaacgatggc
agcgcgcgcgacagcgacggcaccatgctgctgcccgccatcgacgtatgcggctaccac
cgcctggaactcggcgatgcgcacaccgtgctggcaatcgctccgccgcgctgctacggc
gttgccgatgcgctgcggcacgccggccgcgcgggcgaactgacccggccctggggcctg
gcagtgcagctctacggcctgcgccgcggcgcgccctgcggcctgggcgacctgagcgcg
ctgacccagtgctgcatcagcgcagccggcgccagcgccgacgccgtcgccatcaacccg
ctgcacgccggctttgccgccctgcccgagcgctatagcccgtatgcgccgtccagccgc
ctgttcctgaatccgctctatgccgaccccgccgtgcaattcgggcaggccgcggtagac
tgggccgtcgccgcgctcggcgcgggcgagtcgctgcaagcgctggaagcccgcagcgag
atcgactgggtcaagctgacgccgctgcgctacgccatcctgcggtggctatgggagcgc
agcgatgcgctgctgccgcgcgcggcgctcgatgactgcgccgcctttcgcgcgcgcggc
ggcaccgcgctgcacgcgcacgcatgctacgaggcgatccaggcccggcgcctggccgac
agcgccaacggcatgaaccacaaccccgcgcctgactggcgctgctggccggtcacgctg
cgcgcgcccggcgatgccgccgtggcggcctttgcacaggcccatgccaatgaggtcgcc
taccacgctttcctgcaatggattacggccgacggcatggcacgcgcgcagcgtgcggcg
cgcggcgcgggcatggcggtcggcatcgtctccgacctggcggtgggggccgaccctggc
ggcagtcaggcctggacgcggcaacaggaaatcctggcgggcttccatgccggcgcaccg
ccggacctgtacaacccgctcgggcaggactggggcgtggcggtgttctcgccgcgcggg
ctgcgccgccgcggctacgcggccttcctggagatgctgcgcgccaacctggcccatgcc
ggcgggctgcgcatcgaccatgtgctgggcctggcacgcatgtggctggtgcctgccggt
gccccggccagtgaaggcgcctacctgcgctatccgctgcaggacatgttgcggctggtg
gcgctggaatcatggcggcaccgcgccatcatcatcggcgaaaacctgggcacggtgccg
ccggagctgaatgcggcgctgtcggcccgtggcgtgctgggcatcgatgtgctgtggttc
cagcgcgaagagagcgcgccagtggatgcggccgaggcagctcagcgggtgcccgccccg
gcgcccgacaccgtgccggccttcctgcctcccgcagcctggccgcccgatgccatcgcc
accacctcgacccacgacctccccacagtcaccggctggtgggccggccgcgaccttgcg
tggcgcgaccggctgcacctgctggcgccgggcgaaaccctcgcggcgatgcaggccggc
cgtgcgcgcgagcgcggcgcgctctggcaggcgctgtgcgcagcggggctgtgcagcggc
gccgtgccggaccccgccgatgccccgctcgatgccgtgctggcgtggctgggcaccgcg
cgcaccgccatgcgcctggtgccactggaagacctgctgggcgaggccgagcaacccaac
ctgcccggcaccaccagcgtccaccccaactggcagcgccggctcgacgccgatgtacgt
gcgctgttcgataccccgatggtgcgggcgcgcgccaacgccctgcgcggcggccgccac
ggcgcacgccatccgccgccacgcgcgtag

DBGET integrated database retrieval system