KEGG   Ralstonia eutropha H16: H16_B1745Help
Entry
H16_B1745         CDS       T00416                                 

Gene name
h16_B1745
Definition
(GenBank) Zinc-type alcohol dehydrogenase adhd (aldehyde reductase)
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
reh  Ralstonia eutropha H16
Pathway
reh00010  Glycolysis / Gluconeogenesis
reh00071  Fatty acid degradation
reh00350  Tyrosine metabolism
reh00625  Chloroalkane and chloroalkene degradation
reh00626  Naphthalene degradation
reh01100  Metabolic pathways
reh01110  Biosynthesis of secondary metabolites
reh01120  Microbial metabolism in diverse environments
reh01130  Biosynthesis of antibiotics
reh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H16_B1745 (h16_B1745)
  Lipid metabolism
   00071 Fatty acid degradation
    H16_B1745 (h16_B1745)
  Amino acid metabolism
   00350 Tyrosine metabolism
    H16_B1745 (h16_B1745)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    H16_B1745 (h16_B1745)
   00626 Naphthalene degradation
    H16_B1745 (h16_B1745)
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     H16_B1745 (h16_B1745)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: CAJ96527
UniProt: Q0K0E7
Position
2:complement(1981241..1982347)
Genome map
AA seq 368 aa AA seqDB search
MRTKVQAAVMVKARELQVELLDLDEPHDNEVMVEIAATGVCHSDLSVYQAVLPTPLPVIL
GHESAGVVVGLGSQVSGLALGDRVVLSLLAQCGNCFYCNHGQPVLCESGQPSMLQGTMAD
GTTRFTWNGAPVFQMAGLGTLAQRVVVPATSVVPIPDSLPLEQAALLGCGVMTGWGAAVN
TARVEVGEAVAILGCGGVGLHAIQGARTSGASMIIAIDPRTDRLELARSLGATHQLQPGT
GLVEKVRALTGGRGVEVALEVAGRQQSIDDAIRMTRRGGRAVIVSAPGKDVVVNISAFGG
LVLTEKTIRGSLYGSAHVRRDIARLVDLHGAGKLQLDNLASVIYSLDQVNEAMAHCATEA
GGRAIVRP
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacaaaggtgcaggctgccgtgatggtgaaggcccgcgaactccaggtggagttg
ctggacctggatgaaccgcacgataacgaagtgatggtggagattgccgcgacaggcgtg
tgccattcggacctgtcggtgtaccaagcagtgctgccgacaccgctgccagtgatactg
gggcacgaaagcgcgggtgtcgtcgtgggcctgggatctcaggtgtcgggcctggcgctc
ggcgaccgcgtggtgctcagcctgctggcccagtgtggcaactgcttctattgcaaccac
ggccagccggtgttgtgcgagtcggggcagccatcgatgctgcagggcaccatggcagat
ggcacgacgcgatttacatggaatggcgcaccggtgttccagatggccggtctgggaacg
cttgcacagcgggttgtcgtaccggctacatcggtcgttcccatcccggactctctgccg
ctggagcaggcggcattgctcggctgcggggtcatgacgggctggggcgcagcggtcaac
acggcccgggtcgaagtcggcgaagcggtggccatcctcggttgcggcggtgtcggcctg
catgcgatccagggcgcgcgtaccagcggtgccagcatgatcatcgcaatcgatccccgt
acggatcgcctggagctggcgcggtcgctgggtgcgacccatcagctgcagcccgggacc
ggactggtggaaaaggtacgcgcgctcaccggtgggcgcggcgtcgaggtcgcgctggaa
gtcgccgggcgccagcaatccatcgatgacgccatacggatgacccgacgaggcggccgt
gccgtcattgtcagtgcgccgggtaaggacgtggtggtgaacatctccgcgttcggcggg
ctggtgctcacagagaagaccatccgcggctccctctatggttccgctcacgtgcgccgc
gacattgcgcggctggtagacctccacggggcgggcaagctgcaactggacaacctcgcg
tcagtcatctattcgctggaccaggtcaatgaggccatggcgcattgcgccacggaggcg
ggcggtcgggccatcgtgcgcccatga

DBGET integrated database retrieval system