KEGG   Cupriavidus necator H16: H16_B1745Help
Entry
H16_B1745         CDS       T00416                                 

Definition
Zinc-type alcohol dehydrogenase adhd (aldehyde reductase) (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
reh  Cupriavidus necator H16
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    H16_B1745
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H16_B1745
  Lipid metabolism
   00071 Fatty acid degradation
    H16_B1745
  Amino acid metabolism
   00350 Tyrosine metabolism
    H16_B1745
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    H16_B1745
   00626 Naphthalene degradation
    H16_B1745
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     H16_B1745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1981241..1982347)
Genome map
AA seq 368 aa AA seqDB search
MRTKVQAAVMVKARELQVELLDLDEPHDNEVMVEIAATGVCHSDLSVYQAVLPTPLPVIL
GHESAGVVVGLGSQVSGLALGDRVVLSLLAQCGNCFYCNHGQPVLCESGQPSMLQGTMAD
GTTRFTWNGAPVFQMAGLGTLAQRVVVPATSVVPIPDSLPLEQAALLGCGVMTGWGAAVN
TARVEVGEAVAILGCGGVGLHAIQGARTSGASMIIAIDPRTDRLELARSLGATHQLQPGT
GLVEKVRALTGGRGVEVALEVAGRQQSIDDAIRMTRRGGRAVIVSAPGKDVVVNISAFGG
LVLTEKTIRGSLYGSAHVRRDIARLVDLHGAGKLQLDNLASVIYSLDQVNEAMAHCATEA
GGRAIVRP
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacaaaggtgcaggctgccgtgatggtgaaggcccgcgaactccaggtggagttg
ctggacctggatgaaccgcacgataacgaagtgatggtggagattgccgcgacaggcgtg
tgccattcggacctgtcggtgtaccaagcagtgctgccgacaccgctgccagtgatactg
gggcacgaaagcgcgggtgtcgtcgtgggcctgggatctcaggtgtcgggcctggcgctc
ggcgaccgcgtggtgctcagcctgctggcccagtgtggcaactgcttctattgcaaccac
ggccagccggtgttgtgcgagtcggggcagccatcgatgctgcagggcaccatggcagat
ggcacgacgcgatttacatggaatggcgcaccggtgttccagatggccggtctgggaacg
cttgcacagcgggttgtcgtaccggctacatcggtcgttcccatcccggactctctgccg
ctggagcaggcggcattgctcggctgcggggtcatgacgggctggggcgcagcggtcaac
acggcccgggtcgaagtcggcgaagcggtggccatcctcggttgcggcggtgtcggcctg
catgcgatccagggcgcgcgtaccagcggtgccagcatgatcatcgcaatcgatccccgt
acggatcgcctggagctggcgcggtcgctgggtgcgacccatcagctgcagcccgggacc
ggactggtggaaaaggtacgcgcgctcaccggtgggcgcggcgtcgaggtcgcgctggaa
gtcgccgggcgccagcaatccatcgatgacgccatacggatgacccgacgaggcggccgt
gccgtcattgtcagtgcgccgggtaaggacgtggtggtgaacatctccgcgttcggcggg
ctggtgctcacagagaagaccatccgcggctccctctatggttccgctcacgtgcgccgc
gacattgcgcggctggtagacctccacggggcgggcaagctgcaactggacaacctcgcg
tcagtcatctattcgctggaccaggtcaatgaggccatggcgcattgcgccacggaggcg
ggcggtcgggccatcgtgcgcccatga

DBGET integrated database retrieval system