KEGG   Ralstonia eutropha H16: H16_B1745Help
Entry
H16_B1745         CDS       T00416                                 

Definition
Zinc-type alcohol dehydrogenase adhd (aldehyde reductase) (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
reh  Ralstonia eutropha H16
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:reh01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:reh00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:reh00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:reh00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:reh00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:reh00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1981241..1982347)
Genome map
AA seq 368 aa AA seqDB search
MRTKVQAAVMVKARELQVELLDLDEPHDNEVMVEIAATGVCHSDLSVYQAVLPTPLPVIL
GHESAGVVVGLGSQVSGLALGDRVVLSLLAQCGNCFYCNHGQPVLCESGQPSMLQGTMAD
GTTRFTWNGAPVFQMAGLGTLAQRVVVPATSVVPIPDSLPLEQAALLGCGVMTGWGAAVN
TARVEVGEAVAILGCGGVGLHAIQGARTSGASMIIAIDPRTDRLELARSLGATHQLQPGT
GLVEKVRALTGGRGVEVALEVAGRQQSIDDAIRMTRRGGRAVIVSAPGKDVVVNISAFGG
LVLTEKTIRGSLYGSAHVRRDIARLVDLHGAGKLQLDNLASVIYSLDQVNEAMAHCATEA
GGRAIVRP
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacaaaggtgcaggctgccgtgatggtgaaggcccgcgaactccaggtggagttg
ctggacctggatgaaccgcacgataacgaagtgatggtggagattgccgcgacaggcgtg
tgccattcggacctgtcggtgtaccaagcagtgctgccgacaccgctgccagtgatactg
gggcacgaaagcgcgggtgtcgtcgtgggcctgggatctcaggtgtcgggcctggcgctc
ggcgaccgcgtggtgctcagcctgctggcccagtgtggcaactgcttctattgcaaccac
ggccagccggtgttgtgcgagtcggggcagccatcgatgctgcagggcaccatggcagat
ggcacgacgcgatttacatggaatggcgcaccggtgttccagatggccggtctgggaacg
cttgcacagcgggttgtcgtaccggctacatcggtcgttcccatcccggactctctgccg
ctggagcaggcggcattgctcggctgcggggtcatgacgggctggggcgcagcggtcaac
acggcccgggtcgaagtcggcgaagcggtggccatcctcggttgcggcggtgtcggcctg
catgcgatccagggcgcgcgtaccagcggtgccagcatgatcatcgcaatcgatccccgt
acggatcgcctggagctggcgcggtcgctgggtgcgacccatcagctgcagcccgggacc
ggactggtggaaaaggtacgcgcgctcaccggtgggcgcggcgtcgaggtcgcgctggaa
gtcgccgggcgccagcaatccatcgatgacgccatacggatgacccgacgaggcggccgt
gccgtcattgtcagtgcgccgggtaaggacgtggtggtgaacatctccgcgttcggcggg
ctggtgctcacagagaagaccatccgcggctccctctatggttccgctcacgtgcgccgc
gacattgcgcggctggtagacctccacggggcgggcaagctgcaactggacaacctcgcg
tcagtcatctattcgctggaccaggtcaatgaggccatggcgcattgcgccacggaggcg
ggcggtcgggccatcgtgcgcccatga

DBGET integrated database retrieval system