KEGG   Ralstonia eutropha H16: H16_B2000Help
Entry
H16_B2000         CDS       T00416                                 

Definition
class II aldolase/adducin domain protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
reh  Ralstonia eutropha H16
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:reh00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2258245..2259021
Genome map
AA seq 258 aa AA seqDB search
MASTMQLSKSEIVAASLQKIQMELRTQKMPLREAVAETCRILFAFGHDSGLSGQITARAE
QPGTYWTQRLGLGFDEITSDNLLLVNEDLEVLEGSGMPNPANRFHSWLYRARPDLNCIVH
SHAPHASALAMLEVPLVISHMDTCVLYDQCAFLEKWPGIPVGNEEGEIISGALGDKKAIL
LSHHGLLVAGATVEEACVLGVMFERAARLQLLAMAAGPIQPIPHDLGCEAQRWVSTQKRF
EATFAYYSRRARRGLGAE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaccatgcaactgagcaagagcgaaatcgtcgccgcctcgctccagaaaatc
cagatggaactgcgcacgcagaaaatgccgctgcgcgaggcagtagccgaaacctgccgg
atcctgttcgccttcgggcacgactccggcctctcaggccagatcaccgcgcgcgcagaa
cagcctggcacctactggacccagcgcctgggtctgggcttcgacgaaatcacgtccgac
aacctgctgctcgtcaacgaagacctggaagtcctggaaggcagcggcatgccgaacccg
gccaaccgcttccattcctggctctaccgtgcgcgtccggacctgaactgcattgtccat
tcgcacgcgccgcacgcctcggcgctggcgatgctggaggtgccgctggtcatttcgcat
atggacacgtgcgtgctctacgaccagtgcgcgttccttgagaaatggcctggcattcct
gtcggcaatgaagagggagaaatcatctcgggagcccttggtgacaagaaggccatcctg
ttgtcccaccacggcctgctggtggccggtgccacggtggaagaagcctgcgtactgggt
gtgatgttcgagcgtgccgcccggctgcaactgctggccatggcggcgggcccgatccag
ccgatcccgcacgatctgggctgcgaagcgcagcgctgggtcagcacccaaaagcggttc
gaagctacctttgcctactactcgcggcgtgcgcgtcgcgggctgggcgccgaatag

DBGET integrated database retrieval system