KEGG   Ralstonia eutropha H16: H16_B2049Help
Entry
H16_B2049         CDS       T00416                                 

Gene name
cheB2
Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
reh  Ralstonia eutropha H16
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:reh02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2305964..2306983
Genome map
AA seq 339 aa AA seqDB search
MKIGIVNDSALAVAALRRALALDPSFEIAWVAGDGEQAVQMAARQTPDLILMDLLMPVMD
GVEATRRIMSATPCAIVVVTMDLGRNASQVFDAMGHGAIDAVDTPTLVEPDAQLAAGPLL
RKLRNIGRLLAGRVAPQHRLTAAPRAVAAPRLVAIGASAGGPAALATLLGALPADFGAAV
VTVQHVDEAFAAGMADWLDGQCKLPVRIARAGDAPQAGTVLLAGTNDHLRLASPTRMAYS
EQPCDYLYRPSIDVFFESVVEHWRGDVIGVLLTGMGRDGALGLKAMRERGFLTIAQDRAT
SAVYGMPKAAAAMGAAAEILPLPRIAPRLVQACGGTVPL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcggcatcgtcaatgactcggcgcttgcggtagccgcgctgcgccgcgcgctt
gcgctggatccgtcgttcgagatcgcctgggtcgccggcgacggcgaacaggcggtgcag
atggccgcgcgccagaccccggacctgatcctgatggacctgctgatgccggtcatggac
ggcgtcgaggcgacccggcgcatcatgtccgccaccccctgcgccatcgtggtggtgacc
atggacctgggccgcaatgcctcgcaggtgttcgacgcaatgggccacggcgccatcgac
gcggtcgacacccccacgctggtcgagcccgacgcccagcttgccgccgggccgctgctg
cgcaagctgcgcaatatcggccgcctgctggccggccgcgtggccccgcagcataggctg
acggcagcgccgcgcgcagtggccgcaccacggctggtggcgatcggcgcctcggccggc
ggcccggccgcgctggccacgctgctgggcgcgctgccggcggacttcggcgccgcggtg
gtcaccgtgcagcatgtggacgaagcctttgccgccggcatggccgactggctcgacgga
cagtgcaagctgccggtgcgcattgcccgcgccggcgacgcgccccaggccggcacggtg
ctgctggccggcaccaacgaccacctgcgcctggccagtcccacgcgcatggcctactcc
gaacagccctgcgactacctgtaccgcccctccatcgatgtgttctttgaaagcgtggtg
gagcactggcgcggcgacgtgatcggcgtgctgctcaccggcatgggccgcgacggcgcg
ctggggctgaaggcgatgcgcgagcgcggcttcctgaccatcgcccaggaccgcgccacc
agcgccgtgtacggcatgcccaaggccgccgcagccatgggcgcggccgcggagatcctg
ccgctgccgcgcattgcgccgcggctggtgcaggcatgcggcggcaccgtgccgctttga

DBGET integrated database retrieval system