KEGG   Ralstonia eutropha H16: H16_B2168Help
Entry
H16_B2168         CDS       T00416                                 

Definition
flavonol reductase/cinnamoyl-CoA reductase (EC:1.1.1.-)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
reh  Ralstonia eutropha H16
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2455145..2456152)
Genome map
AA seq 335 aa AA seqDB search
MTKNDDVLVTGASGFLGSAVVRRALARGFRVRVLVRPQSPRANLAGLPVSVAEGDMRDAG
AVAAALQGVRYLFHVAADYRLWAPDPEEIVRTNVDGTLAVMEAAQQAGVERVVYTSSVAT
LRVAGARAPVDETAALRPHEAIGAYKRSKVLAERVVEKLVAERGLPAVIVNPSTPIGPRD
VRPTPTGRIIVEAATGKIPAFVDTGLNLAHVDDVAEGHFLALERGQAGERYILGGQDVML
QQMLRDIAQLCGRRPPTMQLPRWPLYPLAYGAEAAARFTGKEPFITVDGLNMSRYRMFFT
SDKARKVLGYQPRPYQEGLRDALEWFRAQGYLDKR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaaaacgatgacgtgctggtgacaggcgcctcgggctttctgggctcggcggtg
gtgcgcagggcgctggcacgcggcttccgggtgcgcgtgctggtgcgcccgcaaagcccg
cgcgccaacttggccgggctgccggtgagcgtggcggaaggcgacatgcgcgacgccggc
gcggtggctgccgcgctgcagggcgtgcgctacctgttccatgtggccgccgactaccgg
ctgtgggcgccggaccccgaggagatcgtgcgcactaacgtcgacggcaccctggccgtg
atggaggccgcgcagcaggccggcgtcgagcgggtggtctataccagcagcgtggcgacg
ctgcgcgtggccggcgcgcgggcgccggtggacgagaccgcggcgctgcgcccgcacgag
gccatcggcgcctacaagcgcagcaaggtgctggccgagcgcgtggtcgaaaaactggtg
gccgagcgcggcctgccggcggtcatcgtcaacccgtccactccgatcggcccgcgcgac
gtgcggccgacgccgaccgggcgcatcatcgtcgaggcggccacgggcaagatccccgcc
tttgtcgataccggcctgaacctggcgcatgtggatgacgtggccgaagggcatttcctg
gcgctggaacgcggccaggccggcgagcgctacatcctgggcggccaggacgtgatgctg
cagcagatgctgcgtgacatcgcgcagctgtgcggccggcgcccgccgaccatgcagctg
ccgcgctggccgctgtacccgctggcgtacggggcggaggcggcggcacgctttaccggc
aaggagccgttcatcactgtagatggactcaatatgtcccggtaccggatgttctttaca
tcagacaaggcgcgcaaggtgctgggctatcagccgcggccataccaggagggtttgcgg
gacgcgctggagtggttccgggcgcaggggtatctcgacaagcgctaa

DBGET integrated database retrieval system