KEGG   Ralstonia eutropha H16: PHG252Help
Entry
PHG252            CDS       T00416                                 

Gene name
nosZ
Definition
nitrous-oxide reductase (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
reh  Ralstonia eutropha H16
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:reh00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    PHG252 (nosZ)
Enzymes [BR:reh01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     PHG252 (nosZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHG1:complement(267860..269791)
Genome map
AA seq 643 aa AA seqDB search
MSKEKASIGNGPGGIGRRQFLGTAALAGLAGVVACTDKGAAPAAAAVGAPASGAHGAAHG
AGASVHLKPGELDTYYGLWSGGHTGDMRVLGLPSGREILRIPCFVPDALVGWGITNESKK
VMGARPDGTLRYTVADTHHTHASYKDGNYDGRYAWVNDKINSRIARIRLDYFICDKITEL
PNVQGFHGIFPDKRDPVDTKINYTTRVFCGGEFGIPLPSAPTEDAGKYRSLFTCVDAETM
AVRWQVLIDGNCDLVATSYDGKLAATNQYNTENGAHFEDMMSAERDACVFFNIARIEAAV
QAGKFKTYGDSKVPVVDGTQAANKDPKTALTAYVSVPKNPHGVNASPDQKYFICAGKLSP
TATVIELSRVLGWFDGKQEKLDDAIVAEVELGLGPLHTAFDGRGNAYTTLFLDSQLVKWN
LDAAIKFHKGDKNAKYVVDRLDLQYQPGHVNASQSETVAADGKYLAVGCKFSKDRFLPVG
PLHPENEQLIDISGQKMVLMADHPVRGEPHDFIIFKRELVRPKQVYALDDFPLAIKDPKE
SGVFRNGRKVTVKITSQAPAFSLREFKLKKGDEVTLILTNLDKIEDLTHGFAIPKYNVNF
IVNPQETASVTFVADKPGVFWCYCTHFCHALHLEMRTRMIVEA
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaagagaaggcatcgatcggcaacggtccaggcggtatcggtcgccgccagttt
ctcggcacggcagcgctggccggcctagcgggggtggtcgcctgcacagacaagggcgcc
gcgcccgcggcggcggccgttggcgcaccggcaagcggggcacacggggccgcgcacggc
gcaggcgcgtccgtgcacctcaagcccggggaactggatacgtactatggcctctggagc
ggcgggcataccggcgacatgcgcgtgctggggctgccgtcggggcgcgagatcctgcgc
atcccgtgcttcgtgcccgatgcgctggtcggctggggcattaccaatgaatcgaagaag
gtgatgggcgcccggccggacggcacgctgcgctacacggtggccgatacccaccatacc
catgcttcgtacaaggacggcaactacgacggccgctatgcctgggtcaacgacaagatc
aattcccgcatcgcgcgcatccgcctcgactacttcatctgcgacaagatcaccgagttg
cccaatgtgcagggcttccacggcatcttcccggacaagcgggatccggtcgacacgaag
atcaactacaccacacgcgtgttctgcggcggcgagtttggcattccgctgcccagtgcg
ccgaccgaggatgccggcaagtaccgcagcctgttcacctgcgtggacgccgagacgatg
gcggtgcgctggcaggtgctgatcgacggcaactgcgacctggtggccacctcctatgac
ggcaagctggcggcgaccaaccagtacaacacggaaaacggcgcgcacttcgaggacatg
atgtccgccgagcgcgatgcctgcgtattcttcaacatcgctcgtatcgaggcggcggtg
caggcgggcaagttcaagacctacggcgattcgaaggtgccggtggtcgacggcacgcaa
gcggccaacaaggacccgaagaccgcgctgacggcctacgtatcggtgccgaagaacccg
cacggggtcaacgccagtcccgaccagaagtacttcatctgcgcgggcaagctctcgccc
acggccacggtgatcgagctgtcgcgcgtgcttggctggttcgacggcaagcaggagaag
ctcgacgatgccatcgtcgccgaggtggagctgggtctcgggccgctgcacacggccttc
gatggccgcggcaatgcctacaccacgctgttcctcgacagccagctcgtgaaatggaat
ctcgatgcggcgatcaagttccacaagggtgacaagaacgccaagtacgtggtcgatcgg
ctggacctgcagtaccagcccggccacgtcaacgcctcgcagtccgagacggttgcggcc
gacggcaagtacctggcggtcggctgcaagttctcgaaggaccgtttcctgccggtcgga
ccgctgcatccggagaacgagcagctgatcgacatctccggccagaagatggtgctgatg
gcggaccacccggtgcgtggcgagccgcatgacttcatcatctttaaacgcgagctggtg
cggccgaagcaggtctacgcgctggacgacttcccgctggcgatcaaggacccgaaggag
tcgggcgtgttccgcaatggccgcaaggtcaccgtgaagatcacgtcgcaggcgccggcc
ttcagcctgcgcgagttcaagctgaagaagggtgacgaggtcacgctgatcctgaccaat
ctcgacaagatcgaggacctgacccacggcttcgcgatcccgaagtacaacgtcaacttc
atcgtcaacccgcaggagacggcatcggtcaccttcgttgccgacaagccgggcgtgttc
tggtgctactgcacccacttctgccacgcactccacctggaaatgcgcacccgcatgatt
gtggaggcctga

DBGET integrated database retrieval system