KEGG   Rhizobium etli bv. mimosae IE4771: IE4771_PD00023Help
Entry
IE4771_PD00023    CDS       T03310                                 

Gene name
vraB
Definition
(GenBank) acetyl-CoA C-acetyltransferase VraB
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rei  Rhizobium etli bv. mimosae IE4771
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:rei00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    IE4771_PD00023 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    IE4771_PD00023 (vraB)
   00640 Propanoate metabolism
    IE4771_PD00023 (vraB)
   00650 Butanoate metabolism
    IE4771_PD00023 (vraB)
  Lipid metabolism
   00071 Fatty acid degradation
    IE4771_PD00023 (vraB)
   00072 Synthesis and degradation of ketone bodies
    IE4771_PD00023 (vraB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IE4771_PD00023 (vraB)
   00310 Lysine degradation
    IE4771_PD00023 (vraB)
   00380 Tryptophan metabolism
    IE4771_PD00023 (vraB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IE4771_PD00023 (vraB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IE4771_PD00023 (vraB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    IE4771_PD00023 (vraB)
Enzymes [BR:rei01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IE4771_PD00023 (vraB)
Exosome [BR:rei04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IE4771_PD00023 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
pRetIE4771d:23219..24412
Genome map
AA seq 397 aa AA seqDB search
MSYAYQPDEDWQPVVVAAYRTPMGRAFGSLATVASEDLLAPVIRRIVAETGIAPEAIDDV
LVGNAAGGGGNIARLAALSAGLPIAVPGVAIDRQCGSGLEAIIMAARLIQAKAGSCFLAG
GVESVSTAPWRAERPKTNGALPRFYGRARFSPDAIGDPDMGVAAENVARAYGITRQRQDE
FALRSHRLAVKAAEAGLFRPEIVEISTGHGLVERDECPRPTTSMERLANLKPVFLADGSV
TAGNACPLNDGACLVLVISRGMARRLGIEKGLAFIDSAAAGVDPNLLGIGPVASTKKLLQ
RQPDLSLSGIGAIEFNEAFAAQVLASLDQLEIRADTVNREGGAIALGHPFGASGAILVTR
LYSQLVRSGTPGATGLAMIGVGGGIGLTALFEVVRLS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
ttgtcttacgcctatcagcctgacgaggattggcagccggtggtggtcgccgcctaccgc
acgccgatgggccgggccttcggctcgcttgcgacggtcgcctccgaagacctgctcgcg
ccggtcatccgccgcatcgttgccgagacgggcattgcgcccgaggccatagacgacgtg
ctggtcggcaatgccgccggcggcggcggcaatatcgcccggctggcggccctttccgcc
ggcctgccgatcgccgttccgggcgtcgccatcgaccggcaatgcggctccggcctcgaa
gcgatcatcatggccgcccggctgatccaggcaaaggccggctcctgctttctggccggc
ggcgtcgagagcgtcagcaccgcgccatggcgggccgagaggccgaaaaccaatggcgcc
ctgccgcgcttctacggccgcgcccggttctcccccgatgcgatcggcgatcctgatatg
ggtgtcgccgccgaaaacgtcgcccgcgcatacggcatcacgcgccagcggcaggatgaa
ttcgccctgcgcagccaccggctcgccgtcaaggcggccgaagccggcctcttccggccg
gaaatcgtcgagatttccaccgggcacgggctggtggaacgggacgaatgcccgcgcccg
acgacatcgatggaacggctggcaaacctcaagcccgtcttcctcgccgacggctcggtg
acggctggcaatgcctgcccgctcaatgacggcgcctgcctggtgctcgtcatcagccgc
ggcatggccagacgcctcggcatcgaaaaaggtctcgccttcatcgacagcgcggcggcg
ggcgtcgacccgaacctgctcggcatcggccccgtcgcctcgaccaaaaaactgctgcag
cgccagcccgatctctcgctttccgggatcggcgccatcgaattcaacgaggctttcgcc
gcccaggtcctggcatcgctcgatcagctcgaaatccgggcagatacggtcaaccgggaa
ggcggcgccatcgcactcggccatcccttcggcgcatctggcgcgatcctcgtgacccgt
ctctacagccagttggtccgcagcggtactcccggcgccaccggtctggcgatgatcggc
gtcggcggtggcatcgggctgacggcgcttttcgaggtggtccggctttcgtga

DBGET integrated database retrieval system