KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_CH00201Help
Entry
REMIM1_CH00201    CDS       T02778                                 

Gene name
deoA
Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
rel00240  Pyrimidine metabolism
rel01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rel00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    REMIM1_CH00201 (deoA)
Enzymes [BR:rel01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     REMIM1_CH00201 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N PYNP_C Ald_Xan_dh_C
Motif
Other DBs
NCBI-ProteinID: AGS20072
UniProt: S5SCZ0
Position
207743..209050
Genome map
AA seq 435 aa AA seqDB search
MIPQEIIRRKRDGEELDAADISSFIAALAAGQLSEGQIGAFAMAVWFKGMSREEIVALTL
AMANSGDRLQWAGIDRPIADKHSTGGVGDNVSLMLAPIVAACGLAVPMISGRGLGHTGGT
LDKLESIPGYRINPDAELFGKVVKEAGCAIIGQTGTLAPADGRLYAVRDVTATVDSIPLI
TASILSKKLAAGLETLVLDVKLGNGAFMADRRQAEMLAHSLVEVANGAGVKTSALITDMN
EPLADCAGNAVEMRNCLGFLAGRKSGTRLETVVFALVAEMLVKSGIAASSEEADAMARRA
LSSGQAAESFARMVSMLGGPADLVENSERYLARAPVEKEVPAARSGWLAACDARGVGISV
IDLGGGRRHPADRIDHRVGFSGLLPLGTRVNAGDPIAVVHAADEAAAEKAAAALAVHYRI
AADRPELAPVIAGLV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgattccgcaggagatcatccggcgtaaacgcgatggcgaggaactcgacgccgccgat
atcagctccttcatcgcggcactcgccgccgggcagctgtccgaaggccagatcggcgcc
ttcgccatggccgtctggttcaaaggcatgtcgcgcgaggaaatcgtggccctgacgctg
gcaatggccaattccggcgacaggctgcaatgggctggcatcgaccgtccgatcgccgac
aaacattcgaccggcggcgtcggcgataatgtctcgctgatgctggcgccgatcgtcgcc
gcctgtggccttgccgtcccgatgatctccgggcgcggcctcggccataccggcggcaca
ctcgataagctcgaatccattcccggctataggatcaaccctgatgcggagctcttcggc
aaggtggtgaaggaggctggatgcgccatcatcggccagaccggaacattggcgcccgcc
gatggccggctttatgccgtgcgcgatgtcaccgccaccgtcgattccattccgctcatc
actgcctccatcctgtcgaagaagctcgcggccggacttgagacgctggtgctcgacgtc
aagctcggcaacggcgccttcatggccgaccgccgtcaggcggagatgctggcgcattcc
ctggtcgaggtggcgaacggcgcgggtgtgaagacctccgccttgatcaccgacatgaat
gagccgctcgccgattgcgccggcaatgcggtcgagatgcgcaactgcttgggcttcctg
gcgggcaggaagagcggcacgcggctcgagaccgtggtttttgcgcttgtcgccgagatg
ctggtcaaatcgggcattgccgcctcctctgaagaggccgacgcgatggcgcgccgagcg
ctgtcgtcgggacaggcggccgaaagcttcgcgcgtatggtatccatgctcggcggaccg
gccgatctcgtcgaaaattcggagagatacctggccagggcgccagtcgaaaaagaagtc
cccgctgcccgatccggctggcttgccgcttgcgacgcgcgcggtgtcggcatcagcgtc
atcgatctcggcggcggccgccggcatccggcagatcggatcgatcaccgcgtcggtttc
tccggcctcctgccgcttggcacccgggtcaatgcgggcgacccgatcgctgtcgttcac
gctgccgacgaagccgcggcggaaaaagcagccgcggcccttgccgtgcattatcgcatt
gctgccgacaggccggaattggcccccgtcattgcaggcctggtctga

DBGET integrated database retrieval system