KEGG   Rhizobium etli bv. mimosae: REMIM1_CH00201Help
Entry
REMIM1_CH00201    CDS       T02778                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
rel  Rhizobium etli bv. mimosae
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rel00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    REMIM1_CH00201 (deoA)
Enzymes [BR:rel01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     REMIM1_CH00201 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
207743..209050
Genome map
AA seq 435 aa AA seqDB search
MIPQEIIRRKRDGEELDAADISSFIAALAAGQLSEGQIGAFAMAVWFKGMSREEIVALTL
AMANSGDRLQWAGIDRPIADKHSTGGVGDNVSLMLAPIVAACGLAVPMISGRGLGHTGGT
LDKLESIPGYRINPDAELFGKVVKEAGCAIIGQTGTLAPADGRLYAVRDVTATVDSIPLI
TASILSKKLAAGLETLVLDVKLGNGAFMADRRQAEMLAHSLVEVANGAGVKTSALITDMN
EPLADCAGNAVEMRNCLGFLAGRKSGTRLETVVFALVAEMLVKSGIAASSEEADAMARRA
LSSGQAAESFARMVSMLGGPADLVENSERYLARAPVEKEVPAARSGWLAACDARGVGISV
IDLGGGRRHPADRIDHRVGFSGLLPLGTRVNAGDPIAVVHAADEAAAEKAAAALAVHYRI
AADRPELAPVIAGLV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgattccgcaggagatcatccggcgtaaacgcgatggcgaggaactcgacgccgccgat
atcagctccttcatcgcggcactcgccgccgggcagctgtccgaaggccagatcggcgcc
ttcgccatggccgtctggttcaaaggcatgtcgcgcgaggaaatcgtggccctgacgctg
gcaatggccaattccggcgacaggctgcaatgggctggcatcgaccgtccgatcgccgac
aaacattcgaccggcggcgtcggcgataatgtctcgctgatgctggcgccgatcgtcgcc
gcctgtggccttgccgtcccgatgatctccgggcgcggcctcggccataccggcggcaca
ctcgataagctcgaatccattcccggctataggatcaaccctgatgcggagctcttcggc
aaggtggtgaaggaggctggatgcgccatcatcggccagaccggaacattggcgcccgcc
gatggccggctttatgccgtgcgcgatgtcaccgccaccgtcgattccattccgctcatc
actgcctccatcctgtcgaagaagctcgcggccggacttgagacgctggtgctcgacgtc
aagctcggcaacggcgccttcatggccgaccgccgtcaggcggagatgctggcgcattcc
ctggtcgaggtggcgaacggcgcgggtgtgaagacctccgccttgatcaccgacatgaat
gagccgctcgccgattgcgccggcaatgcggtcgagatgcgcaactgcttgggcttcctg
gcgggcaggaagagcggcacgcggctcgagaccgtggtttttgcgcttgtcgccgagatg
ctggtcaaatcgggcattgccgcctcctctgaagaggccgacgcgatggcgcgccgagcg
ctgtcgtcgggacaggcggccgaaagcttcgcgcgtatggtatccatgctcggcggaccg
gccgatctcgtcgaaaattcggagagatacctggccagggcgccagtcgaaaaagaagtc
cccgctgcccgatccggctggcttgccgcttgcgacgcgcgcggtgtcggcatcagcgtc
atcgatctcggcggcggccgccggcatccggcagatcggatcgatcaccgcgtcggtttc
tccggcctcctgccgcttggcacccgggtcaatgcgggcgacccgatcgctgtcgttcac
gctgccgacgaagccgcggcggaaaaagcagccgcggcccttgccgtgcattatcgcatt
gctgccgacaggccggaattggcccccgtcattgcaggcctggtctga

DBGET integrated database retrieval system