KEGG   Rhizobium etli bv. mimosae: REMIM1_CH00233Help
Entry
REMIM1_CH00233    CDS       T02778                                 

Definition
glycoside hydrolase family 5 protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rel  Rhizobium etli bv. mimosae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rel00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    REMIM1_CH00233
Enzymes [BR:rel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     REMIM1_CH00233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(242135..243184)
Genome map
AA seq 349 aa AA seqDB search
MGTTRHLVALLLAAALMPSPVFAAGAPCYRGVNLSGGEYGERGAIYATNYIYPSEQTIRY
FAEKGMSIIRLPFRWERLQPALGGRLDEDEFKRIKDTVGLIRKQGMAVLLDPHNFGYYDK
AQVGTAPATDAAFADFWARLAVEFANQDGVLFGLMNEPHDIKATDWLDAANAAIRAIRAV
GARNLILVPGTAWSGAHSWEEDVIGGANGTVMLGVRDPLDFYAYEVHQYLDVDSSGTHAS
CEGAAAAVEALAGVTSWLKRNHKRGFLGEFGGSADKDCMSGLTKIYAIMSGNSDVWLGWS
YWAAGEWWPADEAFNVQPYKGTERPQMQLLAASAKADAGACTAVKTAGN
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggggacgacacgacatctggtggcgctgctgcttgcggccgccctcatgccgtcgccg
gtctttgcggccggcgcgccgtgttatcgcggcgtcaatctttccggcggcgaatatggc
gagcgcggcgccatctacgccacgaactacatctatccgagcgagcagacgatccgctat
ttcgccgaaaagggcatgtcgatcattcggcttccctttcgctgggagcggctgcagccg
gcgctcggcgggcggctggacgaagacgaattcaagcggatcaaggatacggtcggcctg
atccgaaagcagggtatggccgttctgctcgacccgcacaatttcggctattacgataag
gcgcaggtcggcaccgccccggcaacggacgccgcattcgccgacttctgggcgagactc
gcggtcgaattcgccaatcaggacggcgttctcttcggcctgatgaacgagccgcacgac
atcaaggcgacggactggctcgatgccgccaacgcggcgatccgcgctatccgcgccgtc
ggcgctcgcaatctcatcctcgtgccgggtaccgcctggagcggcgctcacagctgggag
gaggatgtgattggcggtgccaacggcacggtgatgctcggcgtgcgcgatccgctcgat
ttctatgcctatgaggtccatcaatatctcgacgtcgattcatcgggaacccatgctagc
tgcgaaggcgccgccgccgcggtcgaggccctcgccggcgtcacctcttggctgaagcgg
aaccataaacgcggttttcttggcgaattcggcggatccgccgataaggactgcatgagc
ggcctcaccaagatctacgccatcatgtccgggaatagtgacgtctggctcggctggtcc
tattgggcggcgggcgaatggtggccggcggacgaagctttcaacgttcagccatacaag
ggaaccgagcgaccgcagatgcagcttctcgccgcctcggcgaaagccgatgccggcgcc
tgcaccgccgtcaagaccgcggggaactga

DBGET integrated database retrieval system