KEGG   Rhizobium etli bv. mimosae: REMIM1_CH00361Help
Entry
REMIM1_CH00361    CDS       T02778                                 

Gene name
mutM
Definition
bifunctional DNA-formamidopyrimidine glycosylase/DNA-(apurinic or apyrimidinic site) lyase (EC:4.2.99.18 3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
rel  Rhizobium etli bv. mimosae
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:rel03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
365016..365906
Genome map
AA seq 296 aa AA seqDB search
MPELPEVETVKRGLAPAMEGARVTRLELRRRDLRFPFPDALAERVSGRTIVGLGRRAKYL
LVDLDDGNTLISHLGMSGSFRIEEGAASAMPGEFHHARSKDEKHDHVVFHLEGGGGPRRV
VYNDPRRFGFMDIVGRADLSAHPFFRDLGPEPTGNELGATYLAERFRDKAQPLKSALLDQ
KNIAGLGNIYVCEALWRSHLSPIRAAGTLVTSGGRPKQQLDLLVASIREVIADAIAAGGS
SLRDHIRADGSLGYFQHSFSVYDREGQACGTPGCGGTVARIVQAGRSTFYCAACQK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgccggaattgccagaagtcgaaacggtcaaacgcgggctggcgccggcgatggagggg
gctcgcgtcacgaggctggagctgcgccgcagggatctgcgcttcccctttcccgatgcc
ctggcggagagggtttccggccgcaccatcgtcgggcttggccgccgcgccaaatatctg
ctggtcgatctcgacgacggcaatacgctgatttcccatctcggcatgtccggttccttc
cgcatcgaggagggtgcggcctcggcgatgccgggcgaattccaccatgcccgcagcaag
gacgagaagcacgatcacgtcgtctttcacctcgaaggcggaggcgggccgcgccgcgtc
gtctataacgatccgcgccgtttcggcttcatggatatcgtggggcgtgccgatctttcc
gcgcatcccttcttccgagacctcggcccggagccgacgggcaacgagctcggcgccacc
tatctcgccgaacggttccgcgataaggcacagcccttgaagagcgcgctcctcgaccag
aagaacatcgccggtctcggcaatatatatgtctgcgaagcgctgtggcgctcgcacctt
tcgccgatccgcgccgccggcacgctggtgacatcaggcggccggccgaagcagcagctc
gacctgctggtcgcctcgatccgcgaggtcatcgccgacgcgatcgccgccggtggctcg
tcgctgcgcgaccatatccgggcggatggatcgctcggctatttccagcattccttctcc
gtctatgatcgcgaaggtcaggcttgcggcacgcccggctgcggcggtacggtcgcccgt
atcgtacaggcgggtcgctccaccttctattgcgccgcctgccagaaataa

DBGET integrated database retrieval system