KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_CH01558Help
Entry
REMIM1_CH01558    CDS       T02778                                 

Definition
endoglucanase protein (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rel00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    REMIM1_CH01558
Enzymes [BR:rel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     REMIM1_CH01558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1581043..1582089
Genome map
AA seq 348 aa AA seqDB search
MRWWCVLLLAATAAFAPASPSAAAQQAMINADAWSAYKAKFLDASGRIVDNGNGNISHSE
GQGYGMLLAYLSASPADFEQIWYFTRTELLLRDDGLAVWKWDPNIKPHVTDTNNASDGDM
LIAYALALAGTAWKRNDYILAASRMAQALLAEAVVRSAGRTLLMPGSEGFGAADRDDGPV
VNPSYWIYEAMPVMAALAPSDAWKELSDDGVALLKTMQFGPRKLPAEWVSLSGAPRPAEG
FDAEFAYNALRIPLYLARGGITDKALLNRLRTGMSQNGVPATIDLTTGRPKTVLLDPGYK
IVNDVVACVVDGTRLPVSALQFAPTLYYPSTLQLLGLAYIGEKHPECL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaggtggtggtgcgtgcttctgcttgcggcgacggctgcgttcgcccccgcaagcccg
tccgccgccgcacagcaggcgatgatcaatgccgatgcgtggtccgcctacaaggcgaag
tttctcgatgcgagcggccggatcgtcgataatggcaacggcaatatcagtcatagcgaa
gggcagggctatggcatgctgctcgcctatctctcggcaagccccgcggatttcgagcag
atctggtattttacccgcaccgagttgctgttgcgcgacgatggcctggccgtctggaaa
tgggatcccaacatcaagccgcacgtgaccgacaccaataatgcctcggatggcgacatg
ctgatcgcctatgccctggcgcttgccggtactgcatggaagcgcaacgactatatcctc
gccgcctctcgcatggcgcaggcgctgcttgccgaagctgtcgtccgctcggcgggccgg
acgctgctgatgccgggcagcgaaggttttggcgccgccgatcgtgacgacggtcctgtc
gtcaatccttcctactggatttacgaggcaatgcctgtcatggcagcacttgctccctcc
gatgcgtggaaagagctgtcggacgatggcgtggcgctgttgaagaccatgcagttcggt
ccgcgcaagcttcctgccgaatgggtcagcctcagtggcgcaccgcgaccggcagagggt
ttcgacgccgagtttgcctataacgccctacgcatcccgctctatctcgcgcgcggcggc
atcacggacaaggcgctgttgaaccgcctgcgaacggggatgtcgcagaatggcgtcccg
gccacgatcgatctgaccacagggcggccgaagaccgtgttgctggacccgggttataaa
attgttaatgatgttgtggcctgtgtagtcgacgggaccaggctgccggtctcggctctg
caattcgcgcccacactctattatccgtccacgcttcaactgctggggctggcctatatc
ggggagaagcatccggagtgtctgtga

DBGET integrated database retrieval system