KEGG   Rhizobium etli bv. mimosae: REMIM1_CH03132Help
Entry
REMIM1_CH03132    CDS       T02778                                 

Gene name
tdk
Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
rel  Rhizobium etli bv. mimosae
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rel00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3106585..3107187)
Genome map
AA seq 200 aa AA seqDB search
MAKLYFNYSTMNAGKSTMLLQASYNYQERGMRTVQLIAAFDERAGRGVIGSRIGLEASAI
PFEPDQDLFRLVMTLSGEGAPISCVFVDEAHFMTPLHVWQLARIVDRLGIPVMVYGLRTD
FQGKLFPASQELLAIADEMREVRTICHCGRKATMVVRLDAQGKVLHEGAQIDVGGNEKYV
SLCRRHWDDEMNGAWIAEPV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagctctatttcaactactcgacgatgaacgccggcaagtcgacgatgctgctg
caggcctcctataattatcaggagcgcggcatgcgtacggtgcagctgatcgccgccttc
gacgagcgcgccggccgcggcgtcatcggctcgcggatcgggctggaggcgagcgccatt
cccttcgaaccggaccaggatctgttccggttggtcatgacgctgagcggcgaaggggcg
ccgatctcctgcgtcttcgtcgacgaggcgcatttcatgacgcctctccatgtgtggcag
cttgcccgcatcgtcgaccggctcggtatccccgtcatggtctacgggctgaggacggat
tttcagggcaagctgtttccggcctcacaggagcttttggcgatcgccgacgaaatgcgc
gaggtgcggacgatctgccactgcgggcgtaaggcgacgatggtggtgcggctggacgcg
cagggaaaggtgctgcatgaaggggcgcagatcgatgtcggcggcaatgagaaatatgtc
tctctctgccgcaggcactgggacgacgaaatgaacggggcctggatcgccgagcctgtg
tga

DBGET integrated database retrieval system