KEGG   Rhizobium etli bv. mimosae: REMIM1_CH03268Help
Entry
REMIM1_CH03268    CDS       T02778                                 

Definition
glycoside hydrolase family 10 protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
rel  Rhizobium etli bv. mimosae
Brite
Enzymes [BR:rel01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     REMIM1_CH03268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3252253..3253326
Genome map
AA seq 357 aa AA seqDB search
MNRRRFLASIPLALLCAGAGQALAQVPPSAGLRALADRKSFRFGSAIDPEDVGNSIASQM
YIDNVNSITPRNQLKWNATEKMPGVFSFGPADQVVGFARRNNMRVYGHTLVWYRTPDWVS
AINDAETIRAAMNRHIKQVVGRYKGSIDAWDVVNEPLEYDVPDLRDCVFRRLLGDDYIRM
SFDMAHEANPDAMLVLNETHLEKKSDVFEQKRVRILKIVEDLVARKTPIGAVGLQSHFRP
GLDRIDPEGMGRFCAALKDMGVGVFITELDASCHFLDRGKVPTPVSYAEVFGDVITIAAE
RGDLKGATVWGMSEKYGELDEKDTNPGASCTKRVNLYDENNDPRSSIDGIKRAIEAM
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaagacgtttcctcgcctccattccgctcgccctgttatgtgccggcgcgggt
caggctttggcccaggtgccgccgtccgcggggctgcgcgcccttgccgacagaaaatcg
tttcgattcggttcggcgatcgatccggaggatgtcggcaattcgattgcgtcgcaaatg
tacatcgacaacgtcaattcgataacgccgcgaaaccagctgaagtggaatgcaacggaa
aagatgccaggcgtcttttccttcggccccgccgatcaagtcgttgggtttgcacgcaga
aataacatgagggtttatggacacacgcttgtctggtatcgcacgcccgactgggtgtcc
gccatcaacgacgctgagaccattcgggcggcgatgaaccgtcatataaaacaagttgtc
ggtcggtataaggggtcgatcgatgcgtgggatgtggtgaacgagccgttggaatatgat
gtgccggatctgcgggactgcgttttccgacgccttcttggcgacgactatatccgcatg
agcttcgacatggcacacgaggccaatcccgatgcgatgctggttctcaacgagacgcac
ttggagaaaaaatccgacgtgttcgaacagaagcgtgtgcgcatcctgaagattgtcgag
gatctcgtcgccagaaagacgccgatcggcgccgtcgggctgcaatcgcatttccgcccc
ggtctcgatcggatcgatccggagggaatgggccgattctgtgcggcgctgaaggatatg
ggtgtcggggtttttatcacggaactcgatgcgtcctgtcacttcctcgaccgcggcaag
gtccccacgccggtctcctatgccgaggttttcggtgacgtgatcaccatcgcagccgag
cgtggtgacttgaaaggcgccaccgtttggggcatgtcggagaaatatggcgagcttgac
gagaaggacaccaatcccggcgcgtcatgcacgaagcgcgttaatctttacgacgaaaac
aacgatccgagaagttcgattgacggcatcaagcgggcaatagaggcaatgtga

DBGET integrated database retrieval system