KEGG   Rhizobium etli bv. mimosae: REMIM1_CH03669Help
Entry
REMIM1_CH03669    CDS       T02778                                 

Gene name
glgB-1
Definition
1,4-alpha-glucan branching enzyme GlgB 1 (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rel  Rhizobium etli bv. mimosae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rel00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    REMIM1_CH03669 (glgB-1)
Enzymes [BR:rel01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     REMIM1_CH03669 (glgB-1)
Exosome [BR:rel04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   REMIM1_CH03669 (glgB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3676360..3678567
Genome map
AA seq 735 aa AA seqDB search
MKTPKTLPEVTLSWEISADEITAILAGSHSNPFAVLGAHQGGDAFVARCFIPGAEEVTAM
TLDGGFIGELKQLHADGVFAGPVSLAKLQPMRYRARRGDAEWAVTDPYSFGPVLGPMDDY
FAREGSHLRLFDKMGAHLIKHEGAQGIHFAVWAPNAQRVSVVGDFNGWDGRRHVMRFRAD
SGIWEIFAPDVPLGVAYKFEIRGHDGVLLPLKADPFARRSELRPKTASIAAAELEQVWED
EAHLKHWRETDKRRQPISIYEVHAGSWQRRQDGTMLSWDELASSLIPYCVDMGFTHIEFL
PITEHPYDPSWGYQTTGLYAPTARFGEPEGFARFVNGCHKVGIGVILDWVPAHFPTDEHG
LGWFDGTALYEHEDPRKGFHPDWNTAIYNFGRTEVVSYLVNNALYWAEKFHLDGLRVDAV
ASMLYLDYSRKHGEWIPNEYGGNENLEAVRFLQDLNIRIYGQHSNVMTIAEESTSWPKVS
QHVHEGGLGFGFKWNMGFMHDTLSYMKRDPVHRKHHHNELTFGLLYAYSENFVLPLSHDE
VVHGKGSLIAKMPGDDWQKFANLRAYYAYMWGYPGKKLLFMGQEFAQWSEWSEAKSLDWN
LLQYRMHEGMRRLVRDLNFTYRSKPALHERDCEGEGFEWLVADDHQNSVFAWLRKAPGQK
PVAVITNFTPVYRENYTIRLPSAGRWREILNTDADIYGGSGKGNGGRVQAVDAGGDITCS
ITLPPLATIMLEPEN
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgccgaaaaccctccctgaagtaacgctttcctgggaaatttcggcagatgaa
atcacggcgatccttgccggctcgcattccaatccctttgccgtcctaggggcgcaccaa
ggcggcgacgctttcgttgcccggtgcttcatcccgggtgcggaggaagtgaccgccatg
acgctcgatggcggttttatcggcgaactgaagcaactccatgccgatggcgtcttcgcc
gggccggtttcgctcgccaaactgcagccgatgcgctaccgcgcccggcgcggcgacgcc
gaatgggcggtcaccgatccctacagcttcgggccggtgctcgggccgatggacgattat
ttcgcccgcgaaggttcgcatctgcgcttgttcgataagatgggtgctcatctcatcaag
cacgaaggcgcccagggcatccacttcgcggtctgggcgccgaacgcccagcgcgtctcc
gtggtcggcgatttcaacggctgggacggccgccgccatgtcatgcgcttccgcgccgac
agcggcatctgggaaattttcgctcccgatgtgccgctcggcgtcgcctacaaattcgag
atccgcggccacgacggcgtgttgctgccgctgaaggctgatcccttcgcccgccgcagc
gagctcagaccgaagaccgcctctatcgccgctgccgagctggagcaggtctgggaggat
gaggcccatctgaagcactggcgcgaaaccgacaagcgccgtcagccgatctcgatctat
gaagtgcatgccggctcctggcagcgccggcaggacggcaccatgctgtcctgggacgag
ctcgcctccagtctcatcccctattgcgtcgacatgggtttcacccatatcgaattcctg
ccgattacagagcatccctacgacccctcttggggctaccagacgacaggtctttacgcg
ccgaccgcccgcttcggcgagccggaaggcttcgcccgtttcgtcaacggctgtcacaag
gtcggtatcggcgtcattctcgactgggtaccggcacatttcccgaccgacgaacacggc
ctcggctggtttgatggcaccgcgctctacgagcacgaagacccgcgcaagggcttccat
cccgactggaacacggcgatctataacttcggccgcaccgaggtggtttcctatctggtc
aacaacgccctctattgggccgagaagttccatcttgacggcctgcgcgtcgatgccgtc
gcctcgatgctctatctcgattattcccggaaacacggcgaatggatcccgaacgaatat
ggcggcaacgagaacctcgaagctgtccgctttctgcaggacctcaacatccgcatctat
ggccagcattccaacgtcatgaccatcgccgaggaatcgacctcctggccgaaagtctcg
caacatgtgcatgaaggcggcctcggcttcggcttcaaatggaacatgggcttcatgcat
gacacgctgagctacatgaagcgcgacccggtgcaccgcaagcaccaccataatgaactc
accttcggcctcctctacgcctattcagaaaatttcgtcctgccgctgtcgcacgacgag
gtcgttcacggaaagggctcgctgatcgccaagatgccgggcgacgactggcagaagttc
gccaatctgcgcgcctactacgcttatatgtggggctatcccggtaagaagttgttgttc
atggggcaggaattcgcccagtggagcgagtggagcgaggcgaagtcgctcgactggaac
ctgttgcaataccgcatgcacgagggcatgcggcgcctggtgcgcgacctcaacttcacc
tatcgcagcaagccggcgctgcatgagcgtgactgcgagggcgagggttttgaatggctg
gttgccgacgaccaccagaattccgtctttgcctggctgcgcaaggcgccgggccagaag
ccggtcgccgtcatcaccaatttcacccccgtctaccgcgagaactacacgatccgcctg
ccgtcagcaggccgctggcgggagatcctgaacaccgatgccgacatttacggcggcagc
ggcaagggcaatggcgggcgcgtgcaggccgtcgatgccggcggcgacatcacctgctcg
atcacgctgccgcccctggcgacaatcatgcttgaacctgaaaattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system