KEGG   Rhizobium etli bv. mimosae Mim1: REMIM1_CH03981Help
Entry
REMIM1_CH03981    CDS       T02778                                 

Gene name
sucA
Definition
2-oxoglutarate dehydrogenase E1 component (EC:1.2.4.2)
Orthology
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
rel  Rhizobium etli bv. mimosae Mim1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rel00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    REMIM1_CH03981 (sucA)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    REMIM1_CH03981 (sucA)
  Amino acid metabolism
   00310 Lysine degradation
    REMIM1_CH03981 (sucA)
   00380 Tryptophan metabolism
    REMIM1_CH03981 (sucA)
Enzymes [BR:rel01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     REMIM1_CH03981 (sucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3999499..4002483)
Genome map
AA seq 994 aa AA seqDB search
MARQEANEQFQITSFLDGANAAYIEQLYARYEEDPASVDDQWRAFFKALEDDPADVKKAA
KGASWRRKNWPLAAGGDLVSALDGNWGIVEKAIETKVKAKAAAEGKPADSTDVLQATRDS
VRAIMMIRAYRMRGHLHAKLDPLGIAAAVDDYRELSPENYGFTSADYDRKIFIDNVLGLE
YATIREMIDILERTYCSTLGVEFMHISNPEEKAWIQERIEGPDKGVAFTPEGKKAILSKL
VEAEGYEQFLDVKFKGTKRFGLDGGESLIPALEQILKRGGHLGLKEAVFGMAHRGRLNVL
SQVMGKPHRAIFHEFKGGSYAPDEVEGSGDVKYHLGASSDREFDGNKVHVSLTANPSHLE
IVDPVVMGKARAKQDMSATVWEGDIIPLSERAKVLPLLIHGDAAFAGQGVIAEILGLSGL
RGHRVAGTMHVIINNQIGFTTNPAFSRSSPYPSDVAKMIEAPILHVNGDDPEAVVYAAKI
ATEFRMKFHKPVVLDMFCYRRYGHNEGDEPSFTQPKMYKVIRGHKTVLQLYAARLVAEGL
LTEGEVEKMKADWRAHLEQEFDAGQHYKPNKADWLDGEWSGLRTADNADEQRRGKTAVPM
KTLKEIGRKLAEIPVGFNAHRTIQRFMENRANMIATGEGLDWAMAEALAFGALCLEGHKI
RLSGQDCERGTFSQRHSVLYDQETEERYIPLANLSPTQARYEVINSMLSEEAVLGFEYGY
SLARPNALTLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGYEGQGPEHSS
ARLERFLQLCAEDNMQVANVTTPANYFHILRRQLKRDFRKPLILMTPKSLLRHKRAVSTL
AELAGESAFHRLLWDDAEVIKDGPIKLQKDNKIRRVVMCSGKVYYDLLEEREKRGIDDIY
LLRVEQLYPFPAKALINELSRFRNAEMVWCQEEPKNMGAWSFIDPFLEWVLAHIDAKYQR
VRYTGRPAAASPATGLMSKHLSQLAAFLEDALGG
NT seq 2985 nt NT seq  +upstreamnt  +downstreamnt
atggcacggcaagaagccaacgagcagtttcagatcacctcgtttctggatggcgccaac
gccgcctatatcgagcagctctatgcgcgctacgaagaggatccggcgtcggttgatgat
caatggcgcgccttcttcaaggcgctggaagacgatcctgccgatgtgaaaaaggcggcc
aagggagcttcctggcgtaggaagaactggcctctggctgccggcggcgatctggtgtcg
gcgctcgacggcaattggggcatcgtcgaaaaggcgatcgaaacgaaggtgaaggccaag
gccgcagccgagggcaagcctgccgacagcaccgacgtgctgcaggcgacgcgcgattcc
gtgcgcgccatcatgatgatccgcgcctaccgcatgcgcggccacctgcatgcaaagctc
gatccgctcggaatcgccgccgccgtcgacgattatcgcgagctgtcgccggaaaattac
ggcttcacatcagccgattacgaccgcaagatcttcatcgacaacgttctcggcctggaa
tacgcgaccatccgcgagatgatcgacatcctcgagcgcacctactgctcaacgctcggc
gtcgaattcatgcatatctccaacccggaagagaaagcatggatccaggaacgcatcgaa
ggccctgacaagggcgtggccttcacgcctgagggcaagaaggccatcctttccaaactc
gtcgaggccgaaggctacgaacagttcctcgacgtcaagttcaagggcaccaagcgcttc
ggtctcgacggcggcgaatcactgatcccggctctggagcagatcctgaagcgcggcggc
catctcggcctcaaggaagcggtcttcggcatggcccatcgcggccgcctgaacgtgctc
tcccaggtcatgggcaagccgcaccgcgccatcttccacgagttcaagggcggatcctac
gcacccgacgaagtcgaaggctcgggcgacgtcaagtaccatctcggcgcttcctccgac
cgcgaattcgacggcaacaaggtgcacgtgtcgctgacggcgaacccgtcgcatctcgaa
atcgtcgatcctgtggtcatgggcaaggcccgcgccaagcaggacatgagcgccaccgtc
tgggaaggcgacatcattccgctgtctgaacgcgccaaggtgctgccgctgctgatccac
ggcgacgcggccttcgcgggccagggcgtcattgccgaaatcctcggtctgtccggtctg
cgcggccaccgcgtcgccggcaccatgcacgtcatcatcaacaaccagattggtttcacc
acgaacccggccttttcgcgctcgtcgccctatccgtctgacgtcgccaagatgattgaa
gcaccgatcctgcacgtcaacggtgacgatccggaagcggtcgtctacgcagccaagatc
gcgaccgaattccgcatgaagttccacaagcctgtggtgctcgacatgttctgctatcgc
cgctacggccacaatgaaggcgacgagccgtccttcacgcagccgaagatgtacaaggtc
attcgcggccacaagaccgtgctgcagctctatgcggcgcgcctcgtcgccgagggcctg
ctcaccgaaggcgaagtcgagaagatgaaggccgactggcgcgcgcatctcgagcaggag
ttcgacgccggccagcactacaagccgaacaaggccgactggctggacggcgagtggtcg
ggcctgcgcacggccgacaatgccgacgaacagcgccgcggcaagactgcggtgccgatg
aagacgctgaaggagatcggccgcaagcttgcggaaatcccggtgggcttcaatgcgcac
cgcacgatccagcgtttcatggaaaaccgggccaacatgattgccacgggggagggcctc
gactgggcgatggccgaagcgctcgctttcggcgcgctctgcctcgaaggccacaagatc
cgcctgtccggtcaggattgcgaacgcggcaccttctcgcagcgccactcggttctctac
gatcaggagaccgaggaacgctacattccgctcgccaatctttcgccgacgcaggcccgt
tacgaagtcatcaactcgatgctttcggaagaggccgtgctcggcttcgaatatggctac
tcgctggcccgcccgaatgcgctcaccctctgggaagcgcagttcggcgatttcgccaac
ggtgcgcaggtggtcttcgaccagttcatctcgtcgggtgagcgcaagtggctgcgcatg
tccggcctcgtctgcctgctgccgcacggctatgagggccagggtccggagcactcctcg
gctcgcctggagcgcttcctgcagctctgcgcggaagacaacatgcaggtcgccaatgtc
acgacgccggcgaactacttccatatcctgcgccggcagctgaagcgcgacttccgcaag
ccgctgatcctgatgacgccgaagtcgctgctgcgtcacaagcgcgcggtttcgacgctt
gccgaactagccggtgaatcggctttccatcgccttctgtgggacgatgcggaggtgatc
aaggacggtccgatcaagctgcagaaggataacaagatccgccgcgtcgtcatgtgctcc
ggcaaggtctattacgaccttctcgaagagcgtgaaaagcgcggcatcgatgacatctat
ctcctgcgcgttgagcagctctatccgttcccggcaaaggcgctgatcaacgagctgtcg
cgcttccgcaatgccgagatggtctggtgtcaggaagagccgaagaacatgggtgcatgg
tcgttcatcgacccgttcctcgagtgggtgctcgcccatatcgatgcgaagtaccagcgc
gtccgctataccggccgtccggccgccgcctcgccggcgacgggcctgatgtccaagcat
ctgtcgcagctcgccgcattcctcgaggatgcgttgggcggctaa

DBGET integrated database retrieval system