KEGG   Rhizobium etli bv. mimosae: REMIM1_PD00425Help
Entry
REMIM1_PD00425    CDS       T02778                                 

Definition
amine oxidase protein
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
rel  Rhizobium etli bv. mimosae
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rel00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    REMIM1_PD00425
   00330 Arginine and proline metabolism
    REMIM1_PD00425
   00340 Histidine metabolism
    REMIM1_PD00425
   00350 Tyrosine metabolism
    REMIM1_PD00425
   00360 Phenylalanine metabolism
    REMIM1_PD00425
   00380 Tryptophan metabolism
    REMIM1_PD00425
Enzymes [BR:rel01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     REMIM1_PD00425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRetMIM1d:451455..452723
Genome map
AA seq 422 aa AA seqDB search
MPRDHIRDADEDVVIIGAGAAGIAAARRLLAVRPGLSVLMLEAGDRLGGRAWTVGLPETG
DLGFDLGCGWLHGARTNAWTAIAGEVGLTVDRSPAPWNGGRRLPRDDAEIERAQQAIGAY
FERLESHEGNDTDLAAKLQPDSRWNGQIRAIGTYVTGAELERSSIADYNRYDPGAGPDWR
VRQGYGTLIALYGAPVRTTLGVEARRVDHRHAGRISIETSQGMISARIVLVTVSTNVLAA
GRIAFDPPLPDKIEAATRLPLGLADKLFLSLTDPEALPADTHMLGSTSRGATGTYQLRPF
GAPVVEAYFAGDLAHDLERAGAKAAFSFAADELAAQFGTDIRKQLSVAAISAWAATPHIG
GSYSYAEPGASDLRGVLAEPHDERIFFAGEACSRSRYSTAHGAYETGVAAADRIAGSSSR
NL
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgtgaccacatcagggacgctgacgaagacgtcgtcattatcggcgccggcgct
gccggtattgccgctgcccgccgcctgctggcagtccgtcccggtctttccgtcctcatg
ctcgaagccggcgaccgtctcggtgggagagcctggacggttgggctgcctgaaactggc
gatctgggtttcgatctcggatgcggctggctgcacggggcgcggaccaatgcctggacg
gcgattgccggtgaggtcggactgacggtcgaccgctcgccggcgccctggaacggcggg
cggcggcttccccgggacgatgcggagatcgagcgcgcgcagcaggcgatcggcgcctat
tttgaacgcctggaaagccatgaaggcaacgataccgacttggcagcaaagctccagccc
gacagtcgctggaacggccagatccgggcgatcggcacttacgtcaccggcgccgaattg
gagcgctcgtcgatcgccgactacaacagatatgatcccggcgccggtcccgactggcgt
gtgcggcagggctacggaacattgatcgcgctctatggcgcgccggtccggacaacgctc
ggcgtcgaagcaaggcgcgtcgatcaccgccatgccggccgtatcagcatcgagacaagc
cagggaatgatcagcgcccgaattgtgctcgtcaccgtttcgacgaatgtgcttgccgcc
ggcaggatcgccttcgaccctcccctgcccgacaagatcgaagcggcaactcgcttgccg
ctggggcttgccgataagctctttctcagcctcaccgatccggaggcgctgccggcggat
acgcatatgctcggctcgaccagtcgcggtgcgaccggcacgtatcagttgcggccgttc
ggcgctcccgtcgtggaggcttattttgccggcgatctcgcgcatgatctggagcgggcg
ggagcaaaggctgccttttcgttcgccgcggatgagctggcggcacaattcggcacggac
atccgcaagcagttgtccgtggcggcgatctcggcatgggccgcgacccctcacatcggc
ggttcctattcttatgcggaacccggcgcctccgatctgcgcggcgtcctcgccgaaccg
catgacgagcggattttctttgccggcgaagcctgttcgcgctcgcgttattcgacggcg
catggcgcctacgagaccggtgttgccgctgccgaccggatcgccggctcgtcgtcgaga
aatctataa

DBGET integrated database retrieval system