KEGG   Rhizobium etli bv. mimosae: REMIM1_PF00643Help
Entry
REMIM1_PF00643    CDS       T02778                                 

Definition
trehalose synthase/alpha amylase protein
Orthology
K05343  
maltose alpha-D-glucosyltransferase/ alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rel  Rhizobium etli bv. mimosae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rel00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRetMIM1f:692832..696113
Genome map
AA seq 1093 aa AA seqDB search
MDTMNPGSVDPLLWYKDAIIYQLHIKSFYDANGDGVGDFAGLHQKLDHIAALGVNAIWLL
PFFPSPRRDDGYDIADYGNVSPDYGTMEDFRAFVDAAHRRNIRVIIELVINHTSDQHPWF
QRARQAPAGSPERDFYVWSDTDQKFPETRIIFLDTEKSNWTWDAAAGAYYWHRFYSHQPD
LNFDSPLVMEELLKVMRFWLETGIDGFRLDAIPYLVEREGTINENLPETHAILKRIRAAL
DATHPGVMLLAEANQWPEDTREYFGEGDECHMAFHFPLMPRMYMAIAKEDRFPITDILRQ
TPEIPENCQWAIFLRNHDELTLEMVTDAERDYLWETYASDKRARINLGIRRRLAPLMERD
RRRIELMNALLLSMPGTPVIYYGDEIGMGDNIYLGDRDGVRTPMQWSPDRNGGFSRTDPA
RLVLPLIADPLYGFEAVNVEAQSTDAHSLLNWTRKMLALRGRHPAFGRGSLRFLSPENRK
ILAYLREYDGETLMCVANLSRLPQAVELDLSSFEGRVPIELTGMSPFPPIGQLTYLLTLP
PYGFFWFQLQADADPPAWRTAPPEQLPDLVTMVLRRGLLDLVDEPRLGRVLSNEILPAYL
AKRRWFGAKDQPLQAARLISATPIPYAEGIVLGELEVDLPDHSESYQLPLAVAWDDAQPT
ALTQQLALGRVRQGRRVGFLTDGFAVEPMARGILRGLADRSRITGRTGTLEFLGTERLDR
LQVTDGMPVHWLSAEQSNSSLIVGDVAMIKLIRHIFPGVHPEVEMTRFLTCAGYDHTAPL
LGEVAHTDSSGRRSTLIIVQGAIRNQGDAWNWMLNNLRRGADELVLNDPAVEPGDDVFQP
LISFVAMIGMRLGELHVVLSGENADEAFSPVVARDDEVEAIKKAVAGEVAYAMSKLAERE
ENADPPIDLLARPLLERRSELVELGASLAESARGTLMTRTHGDFHLGQILVSEGDAVIID
FEGEPAKNLAERRAKTVPLRDVAGLLRSLSYLVATAQLDNDAVTEHENEVRRGAIARFGR
NAEKAFLDAYWQAVSASKALATPPDQRRRILDAFLLEKAAYEVAYEARNRPKWLPIPLAG
LTEIVSRLAGVTA
NT seq 3282 nt NT seq  +upstreamnt  +downstreamnt
atggacacgatgaatcccggtagcgtcgacccgctgctctggtacaaggatgcgatcatc
taccagttgcacatcaagtcgttctacgacgccaatggcgatggtgtcggcgattttgcc
ggcctgcaccagaagctggaccatatcgcagccctcggcgtcaacgccatctggctcctg
cctttctttccctcgccgcgccgcgacgacggctatgacatcgccgattacggcaatgtc
agcccggactacggaacgatggaggatttccgtgccttcgtcgacgccgcacaccggcgc
aatatccgcgtcatcatcgaactcgtcatcaaccacacgtccgaccagcatccctggttc
cagcgcgcccgccaggcgccggcgggatcgccggagcgcgacttctatgtctggtcggac
accgatcagaaatttccggaaacgcgcatcatcttcctcgacacggagaaatccaactgg
acatgggatgcggcggcaggcgcctattattggcaccggttctattcccaccagccggac
ctcaatttcgacagcccgctcgtgatggaggagctgctcaaggtcatgcgcttctggctg
gagaccggcatcgacggtttccgcctcgatgcgattccgtaccttgtcgagcgcgagggg
acgatcaacgaaaatcttcccgagacccatgccatcctcaagcgcatccgcgccgcgctc
gacgccacccatcccggcgtgatgctacttgccgaggccaatcaatggccggaggacacg
cgcgaatatttcggcgaaggcgacgaatgccatatggcattccacttcccgctgatgccg
cgcatgtatatggcgatcgccaaggaagaccgtttcccgatcaccgacatcctgcgccag
acgcctgaaatcccggagaattgccaatgggcgatcttcctgcgcaatcatgacgagctg
acgctggaaatggtcaccgacgccgagcgcgactatctctgggagacctatgcttccgac
aagcgcgcccgcatcaatctcggcatcaggcgacgcctggcaccgctgatggagcgcgac
cgccggcgcatagagctgatgaacgcgcttctgctgtcgatgccgggaacgcccgtgatc
tattacggcgatgagatcggcatgggcgacaacatctatctcggcgaccgcgacggggtg
cgcacgccaatgcaatggtcacccgaccgcaacggcggcttctcccggacggacccggcg
cgtctcgtcctgccgttgatcgccgatccgctttatggcttcgaggccgtcaacgtcgaa
gcccagagcaccgacgcgcattcgctgctcaactggacgcgcaagatgctggcgttgcgc
ggcaggcatccggccttcgggcgcggctcgctgcggtttctctcacctgaaaatcgcaag
atcctcgcctatctccgggaatatgacggcgagacgctgatgtgcgtcgcaaacctgtcg
cggctaccgcaggcagtggagctcgacctgtcgagcttcgagggccgcgtgccgatcgaa
ctgaccggcatgtcgccctttccgcccatcggacaactgacctatctcctgacgctgccg
ccctacggcttcttctggttccaactgcaggccgatgccgatccgccggcatggcgcacc
gcgccgcccgaacagcttcccgatctcgtgacgatggtcctccgccgcggcctgctcgat
ctcgtcgacgagccgcgcctgggacgcgtcctcagcaatgaaattctgcccgcttacctc
gccaagcgacggtggttcggcgcaaaggaccagccgcttcaggcggctcgcctaatctcg
gcgacgcccattccctatgccgaggggatcgttctgggcgaattggaggtggacctgccg
gatcacagcgaatcctatcagttgccgctggcggtcgcctgggatgatgcgcaacccacc
gctctgacgcagcagcttgcgcttgggcgggttcgtcaaggcaggcgggtcggcttcctg
acggatgggttcgcggtcgagccgatggcgcgcggcatcctgcgcgggcttgccgaccgc
tcgcgcatcaccggacgtaccggcacgctcgaatttctcggcaccgagcggctcgaccgc
ctgcaggtcaccgacgggatgccggttcattggctttcggccgagcaatcgaacagctcg
ctgatcgtcggtgacgtcgccatgatcaagctgatccggcatatcttcccgggtgtccat
ccggaggtcgagatgacgcggtttctcacatgcgccggttacgatcacaccgctccactg
ctcggcgaggtcgcgcacaccgattccagcgggcgccgctcgaccttgatcattgttcag
ggcgcgatccgcaaccagggcgacgcctggaactggatgctgaacaatctgcgccgcggc
gccgacgaactcgtgctgaacgacccggcggtcgagcctggcgatgacgtattccagccg
ctgatcagcttcgtcgccatgatcggcatgaggctgggcgagttgcatgtcgtgctttcc
ggggaaaacgcggatgaagctttcagccctgtcgtcgcccgcgacgatgaggtcgaggcg
atcaagaaggcggtggcgggcgaagtcgcctatgccatgtcgaaactggcagaacgcgag
gaaaatgccgatcccccgatcgatctgctcgctcgtccgcttctggagcgccgttccgag
ctcgtggagcttggcgcgagcctggcggagagtgctcggggcacactgatgacgcgcacg
catggcgactttcatctcggccagatcctggtcagcgagggcgatgccgtcatcatcgac
ttcgaaggcgagcccgccaaaaatctcgcggagcgtcgggcgaagacggttccgttgcga
gatgtcgccgggcttctgaggtcgctcagctatctcgtcgccaccgcccagctcgacaat
gacgcggtcaccgaacacgagaacgaggtgcgccggggcgccatcgcccgtttcgggcgc
aatgccgagaaggcctttctcgatgcctattggcaggcggtctccgcatcgaaggctctc
gccacgccgccagatcaacggcggaggattctcgatgcctttcttctcgaaaaggccgcc
tatgaagtcgcctatgaagcccgcaacaggccgaagtggctgccgatcccgcttgccggc
cttaccgaaatcgtatcgcgcttagcgggggtaacggcatga

DBGET integrated database retrieval system