KEGG   Rhizobium etli bv. mimosae: REMIM1_PF00657Help
Entry
REMIM1_PF00657    CDS       T02778                                 

Definition
4-alpha-glucanotransferase protein (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rel  Rhizobium etli bv. mimosae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rel00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    REMIM1_PF00657
Enzymes [BR:rel01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     REMIM1_PF00657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRetMIM1f:716781..718739
Genome map
AA seq 652 aa AA seqDB search
MKSAELDKLARRYGISPTRPSPEDREVTISADTKRKILSALEVELSADRDTRRSRRGQES
ERADQTIPQSFLPDFLLKTRVWGISLQLYELRSARNWGIGDFEDLSDAADLAGKLGADFI
GLNPLHAPFLADPDRCSPYEPSSRQHLNPLYIAVDRLPGFVSSAQLERKLEGLRRSNLVD
YAGVARAKLGTLRDLWRDWLKAGAADETYDPVDFDAFVAGGGNSLRRHALFECLSLFMVE
HGAGAGWQEWPADFRRFDSAAVAEFAREHADEVRFHMWLQWLAHRQLLQAADRAREAGLR
IGLYLDLAVGEAVDGSATWSEPDVYISKATIGSPPDPFAVEGQDWHLAGYLPSAIAAGDS
SPYRRMVSAAMRYAGAIRIDHAPALRRLFLVPLGSRPDGGAYVRYPQHRLLQILAETSAE
YRCLVIGEALGMIPPDLPDELAAAQILSYRILSYEQDGKGFKPPDAYPVFGLTCISTHDH
QTLAGWWRSADIQDRREHGIVPPDLTAKHLQQRRRERRSLKAALRAAGIDVPTRLGARAS
RETLRDLTVSAYRFIARTPSLLVAVRLADLTDEKRPTNIPGTSDSYPNWKPKLSVSLEGL
ASNPLLHRITAAMREERPRIHAARNDQEAGLFRRDRDKDREMKAKDHLSKSP
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctgccgagctcgacaagctcgcccggcgatacgggatcagcccgaccaggccc
agtcccgaggatcgtgaggtgacgatttccgccgacaccaaacgcaagatactctcggct
ttggaagttgaactttcggcagatcgcgacacgaggcgatcgcgacgggggcaggagtcg
gagcgggcggatcagacgatccctcagtcatttctgccggacttcctgctcaagacgcgg
gtctgggggattagcttgcagctttacgaactgcgttcggcgcgaaactggggcatcgga
gatttcgaggatttgtccgatgcggccgacctggcggggaagcttggggctgatttcatc
ggcctcaatccgcttcacgcaccatttcttgccgatcccgatcgctgcagcccctatgaa
ccttcaagccgtcagcatctcaacccgctctatatcgcggtcgaccgattgccaggtttt
gtcagtagtgcccaactcgaacggaaattggagggacttcgccgaagcaacctcgtcgac
tatgccggagttgcgagggccaagcttggaactctgcgggatctctggcgcgactggctg
aaggcgggtgccgccgatgaaacctacgatcccgtcgatttcgatgccttcgtcgcggga
ggcggcaacagcttgcggcgccatgcgctctttgaatgtctttcgcttttcatggtggag
catggggcaggcgccggctggcaggaatggccggcagatttccggcgcttcgacagcgct
gccgtcgccgaattcgcgcgtgagcatgcggacgaggtccgttttcatatgtggctgcag
tggctcgcccacaggcagttgctgcaggcggcggaccgggcgcgcgaagccggcctgcgg
atcgggctctatctcgatcttgccgtgggcgaggcggtagacggatcggcgacatggagc
gagccggatgtctatatctcgaaggcgaccatcggcagccctcccgatccgttcgcggta
gaggggcaggactggcatctcgccggatatctgccgtccgcgatcgctgcgggagacagt
tctccttaccggcgcatggtgagcgccgccatgcgatatgccggtgcgatccgtatcgat
cacgccccggctctccggcgcctctttctggtgcctctcggcagcaggccggatggcggc
gcctatgtccgctacccccagcatcggcttctgcagatcctggccgagacgtccgccgag
tatcgatgcctcgtcatcggtgaagcgttgggaatgatcccgcccgatttgcctgacgag
ctcgcggcggcgcagatcctttcgtatcgcattctctcctatgaacaagacgggaaaggc
ttcaagccgccggatgcctatcccgttttcggcctgacctgcatttcgacgcacgaccat
cagacgcttgccggctggtggcgcagcgccgacatccaggatcgtcgcgagcacggaatc
gtgccgcccgatctcacggcaaaacatctccagcagcgccggcgcgagcgacgaagtctg
aaggcggcgctccgcgctgccggcatcgatgtgccgactcgtctcggtgcaagagcaagt
cgggagaccttgagggacttgactgtcagcgcctaccgcttcatcgcccgtactccatcg
cttctcgtcgcggttaggcttgccgacctgactgacgagaaaaggcccaccaacatccct
ggcacgagcgatagctaccccaactggaagccgaagctgtcggtgtcgctggagggcctg
gcgtcgaacccactcctgcatcgcattacggcggcgatgcgggaggaaaggccacggatt
cacgcggcaaggaacgatcaggaagcaggcctatttcgaagagacagggataaggatcgc
gagatgaaagccaaagaccacttgtcgaagtcgccgtag

DBGET integrated database retrieval system