KEGG   Rhizobium etli bv. mimosae: REMIM1_PF00806Help
Entry
REMIM1_PF00806    CDS       T02778                                 

Definition
xylose isomerase domain-containing protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
rel  Rhizobium etli bv. mimosae
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rel00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    REMIM1_PF00806
   00051 Fructose and mannose metabolism
    REMIM1_PF00806
Enzymes [BR:rel01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     REMIM1_PF00806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRetMIM1f:859952..860950
Genome map
AA seq 332 aa AA seqDB search
MNALNTTRFATRLNSFASGAHLAWSGQSGKPSVMQMAERAARVNGLTDLDLNYPDHVSEK
PADLSRRLGDLGLSINGFAMRYYTNPGFKLGAFTHPDASVRREAIDLTKKGIDAARAAGS
NLMTIWLGQDGFDYAFQADYAKMWQHEIDGIREVCAHDPHCLISVEYKPNEPRSYSLMPD
AATTLLAIKEVGAANLGVTLDFAHVLYADEQPAFAAALIARHSRVLGVHLNDGYAKRDDG
LMVGAVHTLQTIELLRQIRRDGYDGAIYFDTFPDLTGLDPVHECEVNIKTVQRMLKVVDH
LEQDNRLSSAIDRQDAVATQAIVQELMFGAEH
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctttgaacacgacacgtttcgccacgcggctcaactccttcgcatccggcgct
cacctcgcttggtccggacaatccggaaaaccttccgtcatgcagatggcggaacgagcg
gcccgtgtgaacgggctcaccgatttggacctaaactatcctgaccacgtgagcgaaaag
ccggctgacctttccagaaggcttggtgatctcggtctttccatcaatggctttgccatg
cgctactacaccaacccgggtttcaaacttggtgcgtttacccatcctgatgcgtcagtg
cgccgagaggcgatcgatctgaccaagaagggtatcgacgccgcccgcgcggccggatcg
aacctcatgaccatctggctcggtcaggatggcttcgattatgccttccaggcagactat
gcgaagatgtggcaacacgaaatagacggaatccgtgaagtttgcgcgcacgatccgcac
tgcctgatctccgtcgagtataagccgaacgagccccgctcctacagtctgatgcccgac
gctgccaccacgctactggccatcaaggaagtcggcgcagcaaatcttggcgtcacgctc
gatttcgctcacgttctgtatgccgacgagcagcctgctttcgcagccgccctgatcgca
cgccacagccgcgttcttggcgtccacctcaacgacggctacgcaaagcgtgatgatggc
ctgatggtcggagcggtacatacgctccagaccatcgaactgctgcgccagatccggcgc
gacggctatgacggcgcgatctatttcgacacgttcccagatcttaccgggctcgacccg
gtccacgaatgcgaggtcaacatcaagaccgtccaacgaatgttgaaggtcgtcgaccac
ctcgagcaggacaatcgcctttcaagcgcgattgaccgacaggacgccgttgccacgcag
gccatcgttcaggaactgatgttcggcgcggaacactga

  All links  
No link information was found.   
DBGET integrated database retrieval system