KEGG   Rhizobium etli bv. mimosae: REMIM1_PF00811Help
Entry
REMIM1_PF00811    CDS       T02778                                 

Gene name
rbsK-2
Definition
ribokinase 2 (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rel  Rhizobium etli bv. mimosae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rel00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    REMIM1_PF00811 (rbsK-2)
Enzymes [BR:rel01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     REMIM1_PF00811 (rbsK-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pRetMIM1f:865465..866349
Genome map
AA seq 294 aa AA seqDB search
MTSPSPSVVVFGSLHYDIMVQGPARPRKGETVTGDSWHPKCGGKGGNQAVSAAKTGIRSV
MVGAVANDDFGHALTENLARNNVDHRFVKTVSGVGSGMSVAIFDSEGDYGAVIVSGSNLT
LGEPDVDAASEAFAEGAVLLLQNEVPDHANVAAAKAMKSVGGSVILNAAPARSLSPELEG
LVDVLVVNAIEAEQLAALTVVDTLTGAEEAAKLLAARFPTVVVTAGGEGVACATAPGEAF
SMEAIEVELVSTHGAGDEFTGVLAAELARARDIRSALDAANRAAAVLVSTPRAG
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcccgtctccctccgtcgtcgtcttcggcagcctgcattacgacatcatggtg
caaggcccggcgcggcctcggaagggagagacggttactggagacagctggcatccgaaa
tgcggtggcaagggtggcaaccaggccgtatcggcggcaaagacgggaattcgttctgtg
atggtcggagccgtcgccaatgacgacttcggtcatgcgctgactgagaacctagcccgc
aacaatgtcgaccatcgctttgtgaagacggtgtcaggcgtcggcagcggcatgagtgtt
gccattttcgacagtgaaggcgattacggcgcggtcatcgtgtccggaagcaacctcacc
cttggcgaaccggacgtggatgccgcttcggaagcatttgccgagggcgctgtcctgttg
ttgcagaatgaggttcccgatcatgccaatgtcgcagcggcgaaggcgatgaagtcggtc
gggggcagcgttatcctgaacgcagcgcctgcgcgttcgctttcgccggaacttgaggga
ctggtcgacgtgctggtcgtcaacgccatcgaagccgagcagctggccgcgcttactgtg
gtcgacactctgactggcgcggaagaggccgccaagctcctggccgcccggtttccgaca
gtcgtcgtgacggctgggggtgaaggcgtcgcctgtgcgaccgcgcccggcgaagcgttc
tcgatggaggcgatcgaggtcgaattggtgagcacccacggtgctggcgacgagttcacc
ggcgtccttgcggcagaacttgccagggctcgtgacatccgctccgccctggacgctgcc
aatcgagccgccgccgtcctcgtcagcacaccgcgcgccggttga

DBGET integrated database retrieval system