KEGG   Rhizobium etli bv. phaseoli IE4803: IE4803_PC00023Help
Entry
IE4803_PC00023    CDS       T03667                                 

Gene name
vraB
Definition
(GenBank) acetyl-CoA C-acetyltransferase VraB
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rep  Rhizobium etli bv. phaseoli IE4803
Pathway
rep00071  Fatty acid degradation
rep00072  Synthesis and degradation of ketone bodies
rep00280  Valine, leucine and isoleucine degradation
rep00310  Lysine degradation
rep00362  Benzoate degradation
rep00380  Tryptophan metabolism
rep00620  Pyruvate metabolism
rep00630  Glyoxylate and dicarboxylate metabolism
rep00640  Propanoate metabolism
rep00650  Butanoate metabolism
rep00900  Terpenoid backbone biosynthesis
rep01100  Metabolic pathways
rep01110  Biosynthesis of secondary metabolites
rep01120  Microbial metabolism in diverse environments
rep01130  Biosynthesis of antibiotics
rep01200  Carbon metabolism
rep01212  Fatty acid metabolism
rep02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rep00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    IE4803_PC00023 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    IE4803_PC00023 (vraB)
   00640 Propanoate metabolism
    IE4803_PC00023 (vraB)
   00650 Butanoate metabolism
    IE4803_PC00023 (vraB)
  Lipid metabolism
   00071 Fatty acid degradation
    IE4803_PC00023 (vraB)
   00072 Synthesis and degradation of ketone bodies
    IE4803_PC00023 (vraB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IE4803_PC00023 (vraB)
   00310 Lysine degradation
    IE4803_PC00023 (vraB)
   00380 Tryptophan metabolism
    IE4803_PC00023 (vraB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IE4803_PC00023 (vraB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IE4803_PC00023 (vraB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    IE4803_PC00023 (vraB)
Enzymes [BR:rep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IE4803_PC00023 (vraB)
Exosome [BR:rep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IE4803_PC00023 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJC82570
UniProt: A0A0A8GM29
Position
pRetIE4803c:22075..23268
Genome map
AA seq 397 aa AA seqDB search
MSYAYQPDEDWQPVVVAAYRTPIGRAFGSLATVASEDLLAPVIRRIVAETGIAPEAIDDV
LVGNAAGGGGNIARLAALSAGLPIAVPGVAIDRQCGSGLEAIIMAARLIQAKAGSCFLAG
GVESVSTAPLRAERPKTNGALPRFYGRARFSPDAIGDPDMGVAAENVARAYGITRRRQDE
FALRSHRLAVKAAEAGLFRPEIVEISTGHGLVERDECPRPTTSMEALANLKPVFLADGSV
TAGNACPLNDGACLVLVISRGMARRLGIEKGLAFIDSAAAGVDPNLLGIGPVASTKKLLQ
RQPDLSLSGIGAIEFNEAFAAQVLASLDQLEIPADTVNREGGAIALGHPFGASGAILVTR
LYSQLIRSGTPGATGLAMIGIGGGIGLTALFEMVRLS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
ttgtcttacgcctatcagcctgacgaggattggcagccggtggtggtcgccgcctaccgc
acgccgatcggccgtgccttcggctcgcttgcgacggtcgcctccgaagacctgctcgcg
ccggtcatccgccgcatcgttgccgagacgggcattgcgcccgaggccatagacgacgtg
ctggtcggcaatgccgccggcggcggcggcaatatcgcccggctggcggccctttccgcc
ggcctgccgatcgccgttccgggcgtcgccatcgaccggcaatgcggctccggcctcgaa
gcgatcatcatggccgcccggctgatccaggcaaaggccggctcctgcttcctggccggc
ggcgtcgagagcgtcagcaccgcgccattgcgggccgagaggccgaaaaccaatggcgcc
ctgccgcgcttctacggccgcgcccggttctcccccgatgcgatcggcgatcctgatatg
ggtgtcgccgccgaaaacgtcgcccgcgcatacggcatcacgcgccggcggcaggatgaa
ttcgccctgcgcagccaccggctcgccgtcaaggcggccgaagccggcctcttccggccg
gaaatcgtcgagatttccaccgggcacgggctggtggaacgggacgaatgcccgcgcccg
acgacatcgatggaagcgctggcaaacctcaagcccgtcttcctcgccgacggctcggtg
acggctggcaatgcctgcccgctcaatgacggcgcctgcctggtgctcgtcatcagccgc
ggcatggccagacgcctcggcatcgaaaaaggcctcgccttcatcgacagcgcggcggcg
ggcgtcgacccgaacctgctcggcatcggccccgtcgcctcgaccaaaaaactgctgcag
cgccagcccgatctctcgctttccgggatcggcgccatcgaattcaacgaggctttcgcc
gcccaggtcctggcatcgctcgatcagctcgaaatcccggcagatacggtcaaccgggaa
ggcggcgccatcgcactcggccatcccttcggcgcatccggcgcgatcctcgtgacccgt
ctctacagccagctgatccgcagcggtactcccggcgccaccggtctggcgatgatcggc
atcggcggcggcatcgggctgacggcgctgttcgagatggtccggctttcgtga

DBGET integrated database retrieval system