KEGG   Rhizobium etli bv. phaseoli IE4803: IE4803_PD00068Help
Entry
IE4803_PD00068    CDS       T03667                                 

Definition
(GenBank) acetyl-CoA acetyltransferase protein
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
rep  Rhizobium etli bv. phaseoli IE4803
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:rep00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    IE4803_PD00068
   00630 Glyoxylate and dicarboxylate metabolism
    IE4803_PD00068
   00640 Propanoate metabolism
    IE4803_PD00068
   00650 Butanoate metabolism
    IE4803_PD00068
  Lipid metabolism
   00071 Fatty acid degradation
    IE4803_PD00068
   00072 Synthesis and degradation of ketone bodies
    IE4803_PD00068
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    IE4803_PD00068
   00310 Lysine degradation
    IE4803_PD00068
   00380 Tryptophan metabolism
    IE4803_PD00068
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    IE4803_PD00068
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    IE4803_PD00068
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    IE4803_PD00068
Enzymes [BR:rep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     IE4803_PD00068
Exosome [BR:rep04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   IE4803_PD00068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
pRetIE4803d:66580..67767
Genome map
AA seq 395 aa AA seqDB search
MALQDPIVIVGAARTPIGSFQGQLTGAAAPELGAAAISAALERSSVEPEAIEEVVFGCVL
PAGQGQAPARQAAIHAGLPFSTGASTVNKMCGSGMKAVMMAHDLIAAGSASVAVAGGMES
MTNAPYLLDRARGGYRLGHGRVVDHMFLDGLEDAYDKGRLMGSFAEDCAEAYQFTREAQD
NYAIASLTRAQKAIADGCFESEIVPVTVKSGKAEQVASRDEQPGKAKLDKIPTLKPAFRE
GGTVTAANSSSISDGAAALVLMHRSQAELRGLKPLATILGHATHSQAPNLFATAPIGALQ
KLSDRTGLALSEVDLFEINEAFAVVAMAAMRDLDLPHERVNVHGGACALGHPIGASGARI
LVTLLAALQRYDLKRGMAALCIGGGEATAVAIERH
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcattgcaggaccctatcgtcatcgtcggtgcggcacgtaccccgatcggcagcttt
caggggcagctgacgggggcggccgcgcccgaactcggagctgcggcgatcagcgcagca
cttgagcgcagcagcgtcgagcccgaggcgatcgaggaggtcgtcttcggctgcgtgctg
ccggcagggcaggggcaggcgccggcacgccaggcggccatccatgccggcctgccgttt
tcgacaggcgccagcaccgtcaacaaaatgtgcggctcgggcatgaaggctgtcatgatg
gcgcatgacctgatcgccgccggcagtgcctcggtggcggttgccggcggcatggaaagc
atgaccaacgcgccctatctcctcgacagggctcgtggcggctacaggcttggccatggg
cgtgtcgtggatcacatgttcctcgacgggctggaggatgcttatgacaaggggcgcttg
atgggcagcttcgcggaggattgcgccgaggcctatcagttcacgcgcgaggcgcaggac
aactatgcgatcgcctccctgacgcgggcgcagaaggcgattgcggacggctgttttgaa
agcgagatcgtgccggtcacggtcaaatcgggcaaggccgagcaggtggcaagccgcgac
gaacagccgggcaaggccaagctcgacaagattccgacattgaagcccgccttccgcgag
ggcggcacggtgacggcggccaattccagctcgatctccgatggcgcggcagccctggtg
ctgatgcaccgctcgcaggcggaactgcgcgggctcaagccgcttgccacgatcctcggt
catgccacgcattcgcaggcgcccaatcttttcgccaccgcgccgatcggcgcgctgcag
aagctctccgatcgcaccggcctggcgctttcggaggtcgacctgttcgaaatcaacgag
gcattcgcggtcgtcgcaatggcggcgatgcgcgacctcgacctgccgcatgagagggtc
aacgtgcatggtggcgcctgcgcgctcggccatccgatcggcgcgtccggcgcccggatt
ctggtgacgctgcttgcagcgctgcagcgctacgacctgaaacgaggcatggcggcgctc
tgcattggcggcggcgaggcgacggctgtcgctatcgagcggcactag

DBGET integrated database retrieval system