KEGG   Rhodococcus equi: REQ_04640Help
Entry
REQ_04640         CDS       T01352                                 

Gene name
asnB1
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
req  Rhodococcus equi
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:req00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
489757..491520
Genome map
AA seq 587 aa AA seqDB search
MRFDGRRPDVGAVARMSDAMVTRGPDTSGAYAQQSVAFGHRRLCIIDLSARGGQPMVDSE
LRLSLVFNGCIYNYKELREELRQAGYRFFSTADSEVVLKSFHRWGPDCVHRFKGMFAFAV
HEIDSGVVTFARDRLGIKPLFFAQTPERLRFASTLQALLRGGGVDTTIDRAALHHYLSFA
AAVPAPLTMFEGVRKLPPATIRVVQPDGSSTERRYWEPSFEPAPDRASWTPQQWQTALMD
SLRTAVSRRMVADVPVGVLLSGGIDSSLLVALLAEQGQRDLATFSIGFDSAGGESGNEYF
YSDLVARTFATDHHQIHIDPARLPAAVPRAIEAMSEPMLSHDCVAFFLLSEEVSKSVKVV
QSGQGADEILAGYHWYPPLVGVAREQSAEAYAKVYFDRTHDDIAMMLGPDYLVDHDVSTE
FVVRHHDAPGADTAVDAALRLDTTVMLVEDPVKRVDTMTMAWGLEARVPFLDHEFVELAA
TCPPDLKLDGGGKGVLKEASRGLLPDAVIDRTKGYFPVPGIRHLEGGVLDLVRDALRSRS
ARERGLFRPELIEALFAAPNDIRTARGANTMWQVGLLEMWLQAMERL
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
gtgcgattcgacgggaggcggcccgacgtcggcgccgtcgcccggatgtccgacgcgatg
gtgacgcgcggaccggacacgtccggcgcgtacgcgcagcagtcggtggcgttcggtcat
cgccgcctgtgcatcatcgacctctccgcccgcggcgggcagccgatggtcgacagcgag
ctccgcctgtcgctggtcttcaacggctgcatctacaactacaaggagttgcgcgaggag
ctccgtcaggccgggtaccggttcttctcgaccgcggacagcgaggtggtgctcaagagc
ttccatcgttggggccccgactgcgtccaccgcttcaagggcatgttcgccttcgcggtg
cacgagatcgactccggggtggtgacgttcgcccgcgaccggctcgggataaaacctctc
ttcttcgcgcagacgccggagcggttgcggttcgcctcgacgttgcaggcgctgttgcgc
ggcggcggcgtggacacgacgatcgatcgtgcggcattgcaccactacctgagcttcgcg
gcggccgtgcctgccccgctcaccatgttcgagggcgtccgcaagctgccgccggcgacg
atccgggtagtgcaaccggacggtagttccaccgagaggcgctactgggagccgagtttc
gaacccgccccggatcgggcgtcgtggacgccgcagcagtggcagacggctctgatggac
tcgctgcgcaccgccgtctcccgccggatggtcgccgatgtgccggtcggggtgttgctc
tcgggcggtatcgattcgagtctgctcgtggcactgctcgccgagcaggggcagcgggac
ctcgccaccttcagtatcggattcgactcggccggaggcgaatccggaaacgagtacttc
tactccgacctggtcgcccgaacgttcgccaccgaccaccaccagatccacatcgacccg
gcccggctgccggcggcggtgcctcgcgcgatcgaggcgatgagcgaaccgatgctcagc
cacgattgcgttgccttcttcctcctgtcggaagaggtctccaagtcggtcaaggtggtg
cagtccggccagggcgccgacgagatcctcgccggctaccactggtatccgccgctggtc
ggggtggctcgggaacagtccgccgaggcgtacgccaaggtgtacttcgaccggacccac
gacgacatcgcgatgatgctcgggcccgactaccttgtcgatcacgacgtcagtacggag
ttcgtcgtccggcaccacgatgctcccggcgccgacaccgccgtggacgcggcgctgcgg
ctcgacacgacggtgatgctcgtggaggacccggtcaagcgggtggatacgatgacgatg
gcgtgggggctcgaggcccgcgtgccgttcctcgaccacgagttcgtcgagttggccgcc
acgtgtccgccggacctcaagctggacgggggcggcaagggtgtgctcaaggaggccagc
cgcggtctgctcccggacgccgtgatcgaccggaccaaggggtatttcccggtcccgggc
atccggcacctcgagggcggggtcctcgatctggtgcgggatgctctgcgaagtcgcagt
gcccgtgaacgagggttgttccggcccgagttgatcgaggcgttgttcgctgctcccaac
gacatccggaccgcccgcggtgccaacaccatgtggcaggtggggctgctggagatgtgg
ttgcaggccatggagcggttgtga

DBGET integrated database retrieval system