KEGG   Rhodococcus equi: REQ_05850Help
Entry
REQ_05850         CDS       T01352                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
req  Rhodococcus equi
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:req00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
616225..616884
Genome map
AA seq 219 aa AA seqDB search
MGQGSQPRYWRCGRLSVNQLGSESVALATGRPFDQARAEAAVRELLLAVGEDPDRPGLLD
TPARVARAYREVFAGLYTNPDDVLNTTFDEGHQELVLVRDIPMYSTCEHHLVSFHGVAHV
GYIPGPEGRVTGLSKLARLVDLYAKRPQVQERLTSQIADALMAKLAPRGAIVVVEAEHLC
MAMRGIRKPGASTTTSAVRGLFQSNSASRAEALDLILRK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtgggccagggcagtcagccccgatactggaggtgcggtcggttgtcggtgaatcagctg
gggagcgagtcggtcgccctcgccactgggaggcctttcgatcaggcgcgcgcggaagcg
gctgttcgcgagttgctgctcgcggtcggtgaggaccccgaccgcccgggtctgctggac
accccggcgcgcgtcgcacgcgcgtaccgcgaggtcttcgcgggtctgtacaccaacccc
gacgacgtcctgaacacgaccttcgacgagggacaccaggagctggtcctcgtccgcgac
atccccatgtactccacgtgcgagcaccacctggtgtcgttccacggtgtcgcccacgtc
ggctacatcccgggtccggagggtcgcgtgaccggcctgtcgaagctcgcccggttggtc
gatctgtacgccaagcgtccgcaggtgcaggaacggctcaccagccagatcgccgacgcg
ttgatggccaagctcgctccgcgtggcgccatcgtcgtcgtcgaggccgagcacctgtgc
atggccatgcggggcatccgcaagcccggcgccagcacgacgacgtcggcggtgcgggga
ctgttccagtcgaactctgcttcgcgtgccgaggcgctggatctgatcctgcgcaagtga

DBGET integrated database retrieval system