KEGG   Rhodococcus equi: REQ_05860Help
Entry
REQ_05860         CDS       T01352                                 

Gene name
folP1
Definition
dihydropteroate synthase folp1
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
req  Rhodococcus equi
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    REQ_05860 (folP1)
Enzymes [BR:req01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     REQ_05860 (folP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
616881..617726
Genome map
AA seq 281 aa AA seqDB search
MIALPRPGRPVVMGVLNVTADSFSDGGQFLDRDAAVAHGVHLHRLGVDIVDVGGESTRPG
AARVDPKIEAERVAPVVAALVDEGVTVSVDTMRASVAQAAIEAGVTIVNDVSGGRADSDM
ARVVADAGVPWVLMHWRPAGEFVHAGGSTHYDDVVRDVRDELMVQVDAAIAAGVDPSALV
LDPGLGFVKDPDHNWQLLHALPEFVELGFPVLIGASRKRFLGSLLADADGVVRPPSGRET
ATAVISALAAMHGAWGVRVHDAQASLDAIAVASAWARGAQS
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgccttaccgcgccccggccgccccgtcgtgatgggcgtcctcaacgtcaccgcc
gattccttctccgacggtgggcagttcctcgatcgggacgcggccgtcgcgcacggtgtg
cacctgcaccggctcggtgtggacatcgtcgacgtcggtggcgagtccaccaggccgggt
gccgcccgcgtcgatccgaagatcgaagcggagcgcgtggccccggtcgtcgcggctctg
gtggacgagggtgtgaccgtcagcgtcgacaccatgcgggcttcggttgcgcaggctgcg
atcgaggcgggcgtcaccatcgtcaacgacgtctcgggtgggcgtgccgactccgacatg
gcccgcgtcgtcgccgacgccggggtgccctgggtgctgatgcattggcggcccgcgggc
gagttcgtgcatgccggcggctcgacccactacgacgacgtggtgcgcgacgtccgcgac
gagctgatggtccaggtggacgcggcgatcgcggcgggggtggatccgtcggcgctggtg
ctggatccgggtctcggcttcgtcaaggaccccgaccacaactggcagttgctgcacgcg
cttccggaattcgtcgaactcggcttcccggtgttgatcggggcgtcacggaaacgtttt
ctgggatcgctgctcgccgacgccgacggggtggtgcggccgccgtcggggcgggagacg
gccaccgcggtgatctcggcgctcgccgcgatgcacggcgcgtggggcgtacgtgtgcac
gacgcgcaggcctcgctcgatgcgatcgcggtggcgtcggcgtgggcgcgaggtgcccag
agttga

DBGET integrated database retrieval system