KEGG   Rhodococcus equi: REQ_06410Help
Entry
REQ_06410         CDS       T01352                                 

Definition
aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
req  Rhodococcus equi
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:req00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
663964..664791
Genome map
AA seq 275 aa AA seqDB search
MATTMKLGKAELMKTAEKAMLTEVSTAQWTDRQKIALTCRALFDAGHDSGLAGQISARGP
RPGTFLTQRLGLGFDEITEGNLLLVDEDLQVLEGSGMANPANRFHSWIYRARPDVNCIVH
THPLHAAALSMLEIPLQISQMDTAPLYDDCAFLPDWPGVPVGNEEGEIISAALGDKRAIL
LAHHGQLVVGATIEEACSSAHLIERAARLQLLAMAAGEIKPLPPRLAKEAHDWTLTPRRS
EANFGYYARRALRSHPDAIDHDLSNPTAEPDWTAR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgacgatgaagctcggtaaggccgagttgatgaagaccgccgagaaggcgatg
ctcaccgaggtgtcgacggcgcagtggacggatcggcagaagatcgccctcacgtgccgt
gcgctgttcgacgccggtcacgactccgggctcgcgggtcagatctcggcgcgcggtccg
cggccgggaacctttctgacgcagcggctggggctcgggttcgacgagatcaccgagggc
aatctgctgctcgtcgacgaggacctgcaggttctcgaagggagtggaatggcgaacccg
gccaacaggttccacagctggatctaccgggcgcggccggacgtgaactgcatagtccac
acgcatccgctgcacgcggcggcgttgtcgatgctcgagatcccgctgcagatctcgcag
atggacaccgcgccgctctacgacgactgcgcgttcctgcccgactggccgggggtgccc
gtcggcaacgaggagggcgagatcatctccgccgcactgggagacaagcgggcgatcctg
ctcgcgcaccacggacagctggtggtgggggcgacgatcgaggaggcctgctcgtcggca
cacctgatcgaacgcgcggcccggctgcagttgctcgccatggcggcgggcgagatcaag
ccgctcccgccgcggctggcgaaggaagcgcacgactggacgctgaccccgcggcgcagt
gaggcgaacttcggctactacgcccgccgggcgctgcgctcgcacccggacgcgatcgac
cacgacctctcgaatccgaccgccgaacccgattggactgcacggtga

DBGET integrated database retrieval system