KEGG   Rhodococcus equi: REQ_06410Help
Entry
REQ_06410         CDS       T01352                                 

Definition
aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
req  Rhodococcus equi
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    REQ_06410
Enzymes [BR:req01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     REQ_06410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
663964..664791
Genome map
AA seq 275 aa AA seqDB search
MATTMKLGKAELMKTAEKAMLTEVSTAQWTDRQKIALTCRALFDAGHDSGLAGQISARGP
RPGTFLTQRLGLGFDEITEGNLLLVDEDLQVLEGSGMANPANRFHSWIYRARPDVNCIVH
THPLHAAALSMLEIPLQISQMDTAPLYDDCAFLPDWPGVPVGNEEGEIISAALGDKRAIL
LAHHGQLVVGATIEEACSSAHLIERAARLQLLAMAAGEIKPLPPRLAKEAHDWTLTPRRS
EANFGYYARRALRSHPDAIDHDLSNPTAEPDWTAR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgacgatgaagctcggtaaggccgagttgatgaagaccgccgagaaggcgatg
ctcaccgaggtgtcgacggcgcagtggacggatcggcagaagatcgccctcacgtgccgt
gcgctgttcgacgccggtcacgactccgggctcgcgggtcagatctcggcgcgcggtccg
cggccgggaacctttctgacgcagcggctggggctcgggttcgacgagatcaccgagggc
aatctgctgctcgtcgacgaggacctgcaggttctcgaagggagtggaatggcgaacccg
gccaacaggttccacagctggatctaccgggcgcggccggacgtgaactgcatagtccac
acgcatccgctgcacgcggcggcgttgtcgatgctcgagatcccgctgcagatctcgcag
atggacaccgcgccgctctacgacgactgcgcgttcctgcccgactggccgggggtgccc
gtcggcaacgaggagggcgagatcatctccgccgcactgggagacaagcgggcgatcctg
ctcgcgcaccacggacagctggtggtgggggcgacgatcgaggaggcctgctcgtcggca
cacctgatcgaacgcgcggcccggctgcagttgctcgccatggcggcgggcgagatcaag
ccgctcccgccgcggctggcgaaggaagcgcacgactggacgctgaccccgcggcgcagt
gaggcgaacttcggctactacgcccgccgggcgctgcgctcgcacccggacgcgatcgac
cacgacctctcgaatccgaccgccgaacccgattggactgcacggtga

DBGET integrated database retrieval system