KEGG   Rhodococcus equi: REQ_07100Help
Entry
REQ_07100         CDS       T01352                                 

Definition
(GenBank) cytochrome P450 monooxygenase
  KO
K00493  unspecific monooxygenase [EC:1.14.14.1]
Organism
req  Rhodococcus equi
Pathway
req00071  Fatty acid degradation
req00380  Tryptophan metabolism
req00627  Aminobenzoate degradation
req01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    REQ_07100
  Amino acid metabolism
   00380 Tryptophan metabolism
    REQ_07100
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    REQ_07100
Enzymes [BR:req01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     REQ_07100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-ProteinID: CBH46827
UniProt: E4WD23
Position
complement(735675..737078)
Genome map
AA seq 467 aa AA seqDB search
MRVVEKSSTTTVSVPHPPGRLPLVGDVLGVSLHTPVQDSMRLERQLGPIFERKALGHRFV
FVSGADMVAELSDESRFAKNVAPGIAELRGIGGDGLFTAYNEEPNWARAHNLLRPAFTQA
AMRSYHDIMVAVAGELTEHWDTHVDGAPVDVSSDMTKLTLETIGRAGFSYSFDSFRRERP
HPFVEAMVRALTHAQRRTFRKVPLVSKLLYRKSDRQNEQDTAYLAQVVDEVIRQRRDSDA
EGPEDLLEIMLRAARGDDPNRLDEVNIRNQVVTFLVAGHETTSGALSFALHYLAQHPEIL
AKARAEVDAVWGDGTPTFEQVAKLRYVRRVLDETLRLWPTAPAYAREAREDTVLANRYPM
RAGEWVLVLIPSLHRDPAWGSDPERFDPDRFAPERVRGRAPHIYKPFGTGERACIGRQFA
IHEAVLVLGTILRRYDFTADPDYQLRIQERLTLMPVGFTLSLRRRRI
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcgtagagaagtcgagcaccacaaccgtgtccgtcccgcatccgcccgggcgt
ctgcccctcgtgggcgacgtcctgggggtctctctgcacaccccggtgcaggactcgatg
cgactcgaacggcagctgggcccgatcttcgaacgcaaggcgctggggcaccggttcgtg
ttcgtgtcgggtgccgacatggtcgcggaactgtccgacgagtcacgcttcgccaagaac
gtcgcccccggaatcgccgagttgcggggaatcggcggcgacggcctgttcaccgcatac
aacgaggagcccaactgggctcgcgcacacaacctgctgcgtccggcgttcacgcaggcg
gcgatgcgctcgtaccacgacatcatggtggcggtggccggcgaactcaccgagcactgg
gacacccacgtcgacggggcgccggtggatgtgtcgtcggacatgacgaagctgacgctc
gagaccatcggccgggcggggttcagctattcgttcgattcgtttcgcagggagcggccg
cacccgttcgtcgaggcaatggtccgcgcgctcacccacgcccagcggcgcacgttccgg
aaagtgccgctcgtgtcgaagttgctgtaccgcaagtccgatcggcagaacgaacaggac
accgcgtatctcgcacaggtggtcgacgaggtgatccggcagcgccgcgacagcgacgcg
gaggggcccgaggatctgctggagatcatgctgcgggcggcgcgcggggacgacccgaat
cgtctggacgaggtgaacattcggaatcaggtcgtgactttcctggttgccggccacgaa
acgacttcgggcgccttgtcgttcgcgctccactatctggcgcagcatccggagatactg
gcgaaggcgcgcgccgaggtcgacgctgtgtggggtgacggaaccccgaccttcgagcag
gtggcgaagctacgctacgtccgccgtgtcctggacgagacgctgcgcctgtggccgacg
gcgcccgcctacgcgcgcgaggcgcgggaggacacggtactcgcgaaccggtatccgatg
cgggccggcgagtgggtactcgtcctcatcccgtcactgcaccgcgaccccgcgtggggc
tccgaccccgagagattcgacccggaccgcttcgctcccgagcgtgttcgcggccgcgcc
ccgcacatctacaaaccgttcgggaccggcgaacgagcctgtatcggacgccagttcgcg
atccacgaggccgtcctcgtcctcggcacgatcctgcggcgctacgacttcaccgctgac
cccgactaccagctccgcatccaggagcgtctgacgctcatgccggtcggcttcacactg
tcgctgcgccggcgtcggatctga

DBGET integrated database retrieval system