KEGG   Rhodococcus equi: REQ_07970Help
Entry
REQ_07970         CDS       T01352                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase
Organism
req  Rhodococcus equi
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
837663..838679
Genome map
AA seq 338 aa AA seqDB search
MPDVTTASPYLHQRFPELAKSLPHVRLGTSPTPVRKLEGLGIGDRIWLKDDSRFGSGGWG
GNKVRKLEWIIPDVLARKSKRIITVGGLGTNWGLATALYAGQFGIETALALIDQPVDDHV
RAQLARLQRSGATLHFTRTKARTFAVAPWLMVRHMKGGRLPYYLPPGGSSPIGALGYVEA
ALELAAQVDAGEIPEPAHIVAPVGSGGTVAGLLLGLRLAGLRTGVVAVVVNDTLPLGQRE
IRDLAGRSESLLRQRGADLGDIDLRSAPLTVTREYLGPGYGYATAEGRAAQRVGHEFGIP
LDPVYTAKAFAGLLEIDAHTRGGDGPIVMLDTFGPRPD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacgtgacgacggcctctccatacctgcatcagcgttttccggaactggcgaaa
tcccttccgcacgtgcggctggggacgtcgccgacacccgtgcgcaaactcgagggactc
ggcatcggggaccggatctggctcaaggacgacagccgcttcggctccggtgggtggggc
ggcaacaaggttcgcaaactcgagtggatcatccccgacgtcctggcgcggaagtcgaag
cgcatcatcaccgtcggcggtctcgggaccaactggggtctcgcgaccgcgttgtacgcc
ggccagttcgggatcgagaccgcgctggcgctgatcgaccagccggtcgacgaccacgtc
cgtgctcaactcgctcggctgcagcgttccggtgccaccctgcacttcacccgcaccaag
gcccgcaccttcgcggtcgcgccgtggctcatggttcgacacatgaaaggcggccggctg
ccctactacctgcctccgggcggctcctcgccgatcggcgcgctcggctacgtcgaggcc
gcgctggaactggcagcccaggtcgacgccggcgagatccccgaaccggcgcacatcgtc
gcgcccgtcggctcaggcggcaccgtcgccgggctgctcctcgggctacggctcgccggt
ctgcgaaccggcgtcgtcgcggtggtcgtcaacgacaccctgccgttggggcagcgtgag
atccgggatctggcgggacgctccgaatcgttactgcggcaacgcggtgccgacctcggc
gacatcgacctgcgttcggcaccgctgaccgtgacgcgcgaatacctcggccccggttac
ggatacgccaccgcggaagggcgtgccgcgcaacgtgtcgggcacgaattcggcatcccg
ctcgaccccgtctacaccgccaaggcgttcgccggcctgctcgagatcgatgcgcacacg
cgcggtggagacggcccgatcgtcatgctcgacaccttcggtccgcgcccggactga

DBGET integrated database retrieval system