KEGG   Rhodococcus equi: REQ_08210Help
Entry
REQ_08210         CDS       T01352                                 

Definition
thiol peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
req  Rhodococcus equi
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    REQ_08210
  Metabolism of other amino acids
   00480 Glutathione metabolism
    REQ_08210
Enzymes [BR:req01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     REQ_08210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
878154..878648
Genome map
AA seq 164 aa AA seqDB search
MTTPLQNLEINTLGGVPTSLGEYGGRALLVVNVASKCGLTPQYTALEKLASEYAERGLTV
IGIPCNQFMGQEPGTPEEIQTFCSTTYGVTFPLMEKVDVNGENRHPIYAELTETADADGE
AGDIQWNFEKFLIAPDGTVVNRFRPRTEPDAPEVIAAIEAVLPR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgacgactccgttgcagaacctcgaaatcaacaccctcggcggcgtgccgaccagcctc
ggcgaatacggcgggcgcgcactgctcgtggtcaacgtggcctccaagtgcgggctcacc
ccgcagtacacggccctcgaaaagctggcgtcggagtacgccgagcgcggcctcacggtc
atcggcatcccgtgcaaccagttcatgggccaggaaccgggcacccccgaagagatccag
accttctgctccaccacgtacggcgtcaccttccccctgatggagaaggtcgacgtcaac
ggcgagaaccggcacccgatctatgccgagctgaccgagaccgcggacgccgacggcgag
gccggcgacatccagtggaacttcgagaagttcctcatcgcgcccgacggcaccgtcgtc
aaccggttccgtccgcgcaccgaacccgacgcccccgaggtgatcgcggcgatcgaggcc
gtgctgccccgatag

DBGET integrated database retrieval system