KEGG   Rhodococcus hoagii: REQ_08210Help
Entry
REQ_08210         CDS       T01352                                 

Definition
(GenBank) putative thiol peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
req  Rhodococcus hoagii
Pathway
req00480  Glutathione metabolism
req00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    REQ_08210
  Metabolism of other amino acids
   00480 Glutathione metabolism
    REQ_08210
Enzymes [BR:req01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     REQ_08210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: CBH46936
UniProt: E4WDD2
Position
878154..878648
Genome map
AA seq 164 aa AA seqDB search
MTTPLQNLEINTLGGVPTSLGEYGGRALLVVNVASKCGLTPQYTALEKLASEYAERGLTV
IGIPCNQFMGQEPGTPEEIQTFCSTTYGVTFPLMEKVDVNGENRHPIYAELTETADADGE
AGDIQWNFEKFLIAPDGTVVNRFRPRTEPDAPEVIAAIEAVLPR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgacgactccgttgcagaacctcgaaatcaacaccctcggcggcgtgccgaccagcctc
ggcgaatacggcgggcgcgcactgctcgtggtcaacgtggcctccaagtgcgggctcacc
ccgcagtacacggccctcgaaaagctggcgtcggagtacgccgagcgcggcctcacggtc
atcggcatcccgtgcaaccagttcatgggccaggaaccgggcacccccgaagagatccag
accttctgctccaccacgtacggcgtcaccttccccctgatggagaaggtcgacgtcaac
ggcgagaaccggcacccgatctatgccgagctgaccgagaccgcggacgccgacggcgag
gccggcgacatccagtggaacttcgagaagttcctcatcgcgcccgacggcaccgtcgtc
aaccggttccgtccgcgcaccgaacccgacgcccccgaggtgatcgcggcgatcgaggcc
gtgctgccccgatag

DBGET integrated database retrieval system