KEGG   Rhodococcus hoagii: REQ_11440Help
Entry
REQ_11440         CDS       T01352                                 

Definition
(GenBank) putative magnesium chelatase subunit chlI
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
req  Rhodococcus hoagii
Pathway
req00860  Porphyrin and chlorophyll metabolism
req01100  Metabolic pathways
req01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    REQ_11440
Enzymes [BR:req01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     REQ_11440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase Sigma54_activat AAA_5 AAA_PrkA AAA_3 MCM AAA_16 NACHT ABC_tran
Motif
Other DBs
NCBI-ProteinID: CBH47243
UniProt: E4WE89
Position
1200783..1202177
Genome map
AA seq 464 aa AA seqDB search
MVTATPPAHLPRTLGELRASGHVQRPVKEEMRDNLLAALRDGVDPWPGIVGFEETVLPQL
ERALIAGHDVVLLGERGQGKTRLLRTLPLLLDEWTPVIAGSELGEHPYEPITPASLRRAA
ELGGALPVEWRHRTERYAEKLATPDTSVADLVGDVDPIKVAEGRSLGDPETIHFGLVPRA
HRGIVAINELPDLAERIQVSLLNVMEERDIQVRGYTLRLPLDVLLVASANPEDYTNRGRI
ITPLKDRFGAEIRTHYPSLLDDEIAVIRQEANLQASVPHHLLEVLARFTRLLRESTSVDQ
RSGVSARFAVAGAETVSAAAVHRSAVLGEAEAVARPIDLGTVVEVLRGKVEFESGEEGRE
LEILEHLLRRATADTARTRLGGIDMASLVSAVEQGQPVVTGERVTAKALLGELPELDVLD
EVAARLGAQTDGERASAAELALEGLYLARRISKNPDENGQAVYS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtggtgactgccacaccgcccgcgcatctgccccgcactctcggtgaactccgggcgtcc
ggccacgtccagcgtccggtcaaggaggagatgcgtgacaatctgctcgcggccctccgg
gacggcgtggacccgtggcccggcatcgtcggcttcgaggagacggtgctgccgcaactc
gagcgcgccctcatcgccggccacgacgtcgtgctgctcggggagcgaggccagggcaag
acgcgactgctgcgcaccttgccgctgttgctcgacgagtggacgccggtgatcgccggg
tccgaactgggcgagcacccgtacgagccgatcaccccggcctcgctgcgccgggccgcc
gaactcggcggcgcgctgcccgtcgagtggcggcaccgcacggagcgctacgcggagaag
ctcgcgacgccggacacgtcggtcgcggacctggttggcgacgtcgacccgatcaaggtc
gcggagggacgcagcctgggcgatccggagaccatccacttcgggctcgtgccccgcgcg
caccgcggcatcgtcgcgatcaacgagctgcccgacctggccgaacggatccaggtgtcg
ctgctcaacgtcatggaggagcgcgacatccaggtccgcggctacacgctgcggctgccg
ctggacgtgctgctggtggccagcgccaaccccgaggactacaccaaccgcggccggatc
atcactccgctcaaggaccgcttcggcgccgagatccgcacccattacccgtcgttgctc
gacgacgagatcgcggtgatccgccaggaggcgaacctgcaggcgtcggtgccgcaccat
ctgctcgaggtgctggcccggttcactcggctgcttcgcgagtcgacgtcggtggatcag
cggtcgggcgtctcggcccgcttcgcggtggccggtgcggagacggtgagtgccgccgcg
gtgcatcgcagcgccgtgctcggcgaggccgaggcggtggcccggccgatcgacctcggc
accgtcgtcgaggtgctgcgcggcaaggtcgagttcgaatccggcgaggaggggcgagaa
ctcgagattctcgaacatctgctgcgacgtgcgaccgcggacaccgcccgcacccgactc
ggcggtatcgacatggcatcgctcgtgtcggcggtggagcaggggcagcccgtcgtcacc
ggtgagcgggtgaccgcgaaggcgttgctcggggagctaccggaactcgacgtgctcgac
gaggtcgcggcccggctcggggcacagaccgacggcgaacgggcctccgcggccgagctc
gcactcgagggcctctacctggcccggcggatctcgaagaatccggacgagaacgggcag
gcggtgtattcatga

DBGET integrated database retrieval system