KEGG   Rhodococcus equi: REQ_11440Help
Entry
REQ_11440         CDS       T01352                                 

Definition
magnesium chelatase subunit chli
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
req  Rhodococcus equi
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:req00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1200783..1202177
Genome map
AA seq 464 aa AA seqDB search
MVTATPPAHLPRTLGELRASGHVQRPVKEEMRDNLLAALRDGVDPWPGIVGFEETVLPQL
ERALIAGHDVVLLGERGQGKTRLLRTLPLLLDEWTPVIAGSELGEHPYEPITPASLRRAA
ELGGALPVEWRHRTERYAEKLATPDTSVADLVGDVDPIKVAEGRSLGDPETIHFGLVPRA
HRGIVAINELPDLAERIQVSLLNVMEERDIQVRGYTLRLPLDVLLVASANPEDYTNRGRI
ITPLKDRFGAEIRTHYPSLLDDEIAVIRQEANLQASVPHHLLEVLARFTRLLRESTSVDQ
RSGVSARFAVAGAETVSAAAVHRSAVLGEAEAVARPIDLGTVVEVLRGKVEFESGEEGRE
LEILEHLLRRATADTARTRLGGIDMASLVSAVEQGQPVVTGERVTAKALLGELPELDVLD
EVAARLGAQTDGERASAAELALEGLYLARRISKNPDENGQAVYS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtggtgactgccacaccgcccgcgcatctgccccgcactctcggtgaactccgggcgtcc
ggccacgtccagcgtccggtcaaggaggagatgcgtgacaatctgctcgcggccctccgg
gacggcgtggacccgtggcccggcatcgtcggcttcgaggagacggtgctgccgcaactc
gagcgcgccctcatcgccggccacgacgtcgtgctgctcggggagcgaggccagggcaag
acgcgactgctgcgcaccttgccgctgttgctcgacgagtggacgccggtgatcgccggg
tccgaactgggcgagcacccgtacgagccgatcaccccggcctcgctgcgccgggccgcc
gaactcggcggcgcgctgcccgtcgagtggcggcaccgcacggagcgctacgcggagaag
ctcgcgacgccggacacgtcggtcgcggacctggttggcgacgtcgacccgatcaaggtc
gcggagggacgcagcctgggcgatccggagaccatccacttcgggctcgtgccccgcgcg
caccgcggcatcgtcgcgatcaacgagctgcccgacctggccgaacggatccaggtgtcg
ctgctcaacgtcatggaggagcgcgacatccaggtccgcggctacacgctgcggctgccg
ctggacgtgctgctggtggccagcgccaaccccgaggactacaccaaccgcggccggatc
atcactccgctcaaggaccgcttcggcgccgagatccgcacccattacccgtcgttgctc
gacgacgagatcgcggtgatccgccaggaggcgaacctgcaggcgtcggtgccgcaccat
ctgctcgaggtgctggcccggttcactcggctgcttcgcgagtcgacgtcggtggatcag
cggtcgggcgtctcggcccgcttcgcggtggccggtgcggagacggtgagtgccgccgcg
gtgcatcgcagcgccgtgctcggcgaggccgaggcggtggcccggccgatcgacctcggc
accgtcgtcgaggtgctgcgcggcaaggtcgagttcgaatccggcgaggaggggcgagaa
ctcgagattctcgaacatctgctgcgacgtgcgaccgcggacaccgcccgcacccgactc
ggcggtatcgacatggcatcgctcgtgtcggcggtggagcaggggcagcccgtcgtcacc
ggtgagcgggtgaccgcgaaggcgttgctcggggagctaccggaactcgacgtgctcgac
gaggtcgcggcccggctcggggcacagaccgacggcgaacgggcctccgcggccgagctc
gcactcgagggcctctacctggcccggcggatctcgaagaatccggacgagaacgggcag
gcggtgtattcatga

DBGET integrated database retrieval system