KEGG   Rhodococcus equi: REQ_11740Help
Entry
REQ_11740         CDS       T01352                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
req  Rhodococcus equi
Pathway
req00040  Pentose and glucuronate interconversions
req00052  Galactose metabolism
req00500  Starch and sucrose metabolism
req00520  Amino sugar and nucleotide sugar metabolism
req01100  Metabolic pathways
req01130  Biosynthesis of antibiotics
Module
req_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    REQ_11740 (galU)
   00052 Galactose metabolism
    REQ_11740 (galU)
   00500 Starch and sucrose metabolism
    REQ_11740 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    REQ_11740 (galU)
Enzymes [BR:req01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     REQ_11740 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Imm75 IspD
Motif
Other DBs
NCBI-ProteinID: CBH47272
UniProt: E4WEB8
Position
1224998..1225921
Genome map
AA seq 307 aa AA seqDB search
MTDAVTNDNRCFRTAVVPAAGMGTRFLPATKTVPKELLPVVDTPGIELVAGEAADSGANR
LVIVTSPGKDGVVAHFVEDLVLESKLEASGKYHLLEKVRKAPGLLEVDSVVQAEPLGLGH
AVGCAEAVLDDDEDAIAVLLPDDLVMPRGVLETMARVRAKRGGSVLCAIDVPKEQVSAYG
VFDVETVPDATNPDVLKVVGMVEKPAMEDAPSTFAAAGRYLLDRAIFDALRRIEPGAGGE
LQLTDAIALLISEGHPVHVVVHRGTRHDLGNPGGYLRAAVDFALNSDEYGPSLREWLADR
LQQPSAE
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgacagatgccgtcaccaatgacaacaggtgcttccggacggcggtcgtgcccgctgca
gggatgggaacacggttcctacctgcgacgaagaccgttccgaaggagttactcccggtg
gtcgacacgccgggcatcgagttggtggcgggtgaggcggccgattcgggggcgaaccgt
ctcgtcatcgtgacctcgcccggtaaggacggtgtcgtcgctcacttcgtcgaggacctc
gtcctcgagagcaagctcgaagccagcggcaagtaccacctgctcgagaaggtccggaag
gctccgggactgctggaggtcgactccgtcgtgcaggccgagccgctgggcctcggtcac
gcggtcgggtgcgccgaagcggtgctcgacgacgacgaggacgccatcgcggtgctcctg
ccggacgatctggtgatgccgcgcggcgtgctcgagaccatggcgcgggtgcgcgccaag
cgcggcggcagcgtgctgtgcgccatcgacgtgcccaaggagcaggtcagcgcgtacggc
gtgttcgacgtcgagacagtcccggacgcgaccaacccggacgtcctcaaggtcgtcgga
atggtcgagaagccggcgatggaggacgctccgtccaccttcgccgcggccggccggtac
ctgctcgaccgcgcgatcttcgacgccttgcgccggatcgagccgggcgcgggcggcgaa
ctccagctcaccgacgccatcgcactgctgatctccgagggacatcccgtccacgtcgtg
gtccatcgcggaactcgacacgatctgggaaatcccggcggttacctgcgggctgcggtt
gactttgcgttgaacagcgacgagtacggtccgtcgctgcgtgagtggctggccgaccga
ctgcagcagccttccgccgaatag

DBGET integrated database retrieval system