KEGG   Rhodococcus equi: REQ_12180Help
Entry
REQ_12180         CDS       T01352                                 

Definition
4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
req  Rhodococcus equi
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    REQ_12180
Enzymes [BR:req01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     REQ_12180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1270333..1271268
Genome map
AA seq 311 aa AA seqDB search
MLSVVPRPVTVRAPSKVNLHLSVGDLREDGYHELRTVFQALSLADDVSVIASDALSVRVR
GEGAESVPTDHTNLVWKAAEMLAAEAGIAPDVEISIVKGIPVAGGMAGGSADAAAALVAL
NELWRLGLDRDALSVFAARLGSDVPFSLHGGTAVGTGRGEKLLPVLSRDSFHWVLALAKG
GLSTPTVFRELDRLRVEGDPPRVGDVDDLMHALASGDAEALAPLLGNDLQAAALSLAPDL
RRTLRAGVTAGALAGIVSGSGPTCAFLCADADAAVAVGAELSGAGVCRTVRVASGPVPGA
RVIDSEPEGSL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtgctttccgtcgttcctcgccccgtcaccgtccgggcgccgtccaaggtcaacctgcac
ctgtcggtaggtgacctgagggaggacggctaccacgagctgcgcaccgtcttccaggcg
ctgtccctcgcggacgacgtgtccgtgatcgcgtcggacgcgctgtcggtccgtgtgcgc
ggtgagggcgccgagtcggtgcccaccgaccacaccaacctcgtctggaaggccgccgag
atgctggccgccgaggcggggatcgcgcccgacgtggagatctcgatcgtcaagggcatc
ccggtggcgggcggaatggccggcggcagcgccgacgcggcggccgcgctggtcgcgctc
aacgaactgtggcggctcgggctcgatcgggacgccctttccgtgttcgccgcccgcctc
ggcagtgacgtcccgttctccctgcacggcggcaccgccgtcggcaccgggcgcggcgag
aagctgctgccggtgctctcccgcgattcgttccactgggtgctcgccctcgccaagggt
ggactgtcgacgccgacggtgttccgtgaactcgatcgacttcgcgtggagggtgacccg
ccgcgggtcggcgacgtcgacgatctcatgcacgcgctcgcgtccggtgacgcggaggcg
ctggctccgctgctcggcaacgacctgcaggcggcggcgctgtcgctggcccccgacctg
cggcgcacgctgcgcgccggcgtgacggccggtgcgctcgcgggcatcgtgtccggctcc
ggtcccacgtgcgcgttcctgtgtgcggatgccgacgccgcggtcgcggtgggggcggaa
ctctcgggtgcgggagtgtgccgcaccgtgcgtgtcgcgagcgggccggtgcccggcgca
cgcgtgatcgactccgagccggaaggcagcctctga

DBGET integrated database retrieval system