KEGG   Rhodococcus equi: REQ_13100Help
Entry
REQ_13100         CDS       T01352                                 

Definition
epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
req  Rhodococcus equi
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    REQ_13100
Enzymes [BR:req01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     REQ_13100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1366197..1366619)
Genome map
AA seq 140 aa AA seqDB search
MENRPDAAVQVVEDFFAALTDMDVDRAVEHLTPDIVWQNTTLPTLRGLSAVRRALAFANK
PTRRFEAVMQNIASDGDAVLTERIDTLFVGPLRSTFWVCGTFELRDGRIAVWRDRFSWGN
VAVGTVTATARALRGGDRRG
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaaccgaccggacgcagcagtacaggtagtcgaggacttcttcgcggccctcacc
gacatggacgtcgaccgcgcggtcgagcacctcaccccggacatcgtgtggcagaacacg
acactcccgacattgcgcggactgtccgcggtccggcgggcactcgctttcgcgaacaag
ccgactcggcgtttcgaggcggtgatgcagaacatcgcgagcgacggcgacgctgtcctc
accgaacgtatcgacacgctgttcgtcggcccgctgcgctcgacgttctgggtgtgcgga
accttcgagttgcgcgacggccggatcgcggtctggcgggaccgcttcagctggggcaac
gtggctgtgggcaccgtcaccgcgacggcccgcgcactccggggtggtgaccgtcgcggg
tag

DBGET integrated database retrieval system