KEGG   Rhodococcus equi: REQ_13580Help
Entry
REQ_13580         CDS       T01352                                 

Definition
ferredoxin domain gmc oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
req  Rhodococcus equi
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    REQ_13580
Enzymes [BR:req01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     REQ_13580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1410686..1412425
Genome map
AA seq 579 aa AA seqDB search
MTHYDVVVIGSGFGGSVAALRLTEKGYRVGVLEAGRRFADDELPQTSWRLRRYLWAPWLG
CYGVQRMHLLPDVLVMAGAGVGGGSLNYANTLYRPPAAFFRESPWGHITDWERELAPYYE
QAERMLGVRENPTFTAADEVMRSVAEELGVGQTFTSTPVGVFFGEPGARVPDPFFGGAGP
DRTGCTECGSCMTGCRVGAKNTLVKNYLYLAERAGATIHPMTTVEEVRPRAGGGYTVTGR
VTGGIRRPRATFTADQVVVAAGTYGTARLLLSMRDRGLLPKLSPRLGAVVRTNSEAVLAA
AARTRSVDFTHGVAITSSFHPDDHTHIEPVRYGKGSNVIGLLQALLTDGGGRVPRPLRAV
GVALRNPGAFLRTLSVRHWSERTVIALVMQTDDNSLELAGKKGLFGRRRLTSRPGPGAPP
PEWIPVGHEVIRRVAERIGGDAGGSLLDLVNIPMTAHFLGGCTIGDSAATGVVDPYLRAY
GHEGLHVVDGSVVSANLGVNPSLTITAQAERAMALWPNKGENDSRPDLDAPYEAVAPVVP
AHPTVPPEAPGALRLPVSPVSHSSAAGDRHERGERPCGA
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgacgcactacgacgtggtggtgatcggttcgggcttcggcgggagcgtcgccgccctg
cgcctcaccgagaaggggtatcgcgtcggtgtcctggaggccggacggcgcttcgcggac
gacgaactgccgcagacgtcgtggcggctgcggcggtacctgtgggcgccgtggctcggc
tgctacggcgtgcaacggatgcatctgcttccggacgtcctcgtgatggccggtgccggt
gtgggtggtgggtccctcaactacgccaacacgctctaccggcctccggccgcattcttc
cgcgaatccccgtggggtcacatcaccgattgggagcgtgaactcgcgccctactacgag
caggccgaacgaatgctcggcgtccgggagaacccgaccttcaccgccgccgacgaggtg
atgcgttcggtcgcagaggaactgggcgtcgggcagacgttcacatccacgccggtaggg
gtgttcttcggtgaacccggcgcacgtgtcccggaccccttcttcggcggtgccggcccg
gaccggaccggttgcacagagtgcggaagctgcatgaccgggtgccgcgtcggagccaag
aacaccctcgtgaagaactacctttacctcgccgaacgcgccggagcgaccatccacccc
atgaccacggtggaggaggtgcgcccgcgcgccggcggtggctacacggtcaccggccgc
gtcaccggcgggattcggagaccgcgcgccacgttcaccgccgaccaggtcgtcgtcgcc
gcaggcacctacgggaccgcccgactgctgttgtccatgcgcgatcgtggcctacttccg
aagctgtcgccccgactgggcgccgtggtgcggacgaattcggaagcggtgctcgctgcg
gccgcgagaacgcggtcggtggacttcacgcacggggtggccatcacgtcctctttccat
cccgacgatcacacccatatcgagcccgttcgatacggcaagggcagcaacgtgatcggg
ttgctgcaggcgcttctcaccgacggtggcggacgcgtgccccgaccgctgagggcagtg
ggagtggcgctgcggaacccgggcgccttcctgcggacgctgtcggtgcggcactggtcc
gagcgcacggtgatcgcactggtcatgcagaccgacgacaactcgctcgagctcgccggc
aagaagggtctgttcggtcggcgcagactcaccagccgtccgggtccgggggcgccacca
cccgagtggatcccggtggggcacgaggtcatccgccgcgtggccgagcggatcgggggc
gacgcgggcgggtcactgctcgatctggtgaacatcccgatgacggcgcacttcctcggc
ggttgcaccatcggggacagtgccgcgaccggcgtggtcgacccgtacctgcgggcgtac
gggcacgaggggctccacgtcgtggacggttcggtcgtcagcgcgaacctcggcgtcaac
ccgtcgctgacgatcaccgcgcaggccgaacgtgcgatggctctgtggcccaacaagggc
gagaacgactctcgtcccgacctcgacgcgccgtacgaggcggtcgcgccggttgtcccg
gcgcaccccaccgtgccgccggaggcgccgggcgcgctgcgtctgcccgtgtccccggtg
agccattcgtccgcagccggggatcgccacgagagaggggaacgtccgtgtggagcgtga

DBGET integrated database retrieval system