KEGG   Rhodococcus equi: REQ_14370Help
Entry
REQ_14370         CDS       T01352                                 

Gene name
folP2
Definition
dihydropteroate synthase folp2
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
req  Rhodococcus equi
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    REQ_14370 (folP2)
Enzymes [BR:req01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     REQ_14370 (folP2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1492337..1493263
Genome map
AA seq 308 aa AA seqDB search
MAPRPASDNDSVTSAPWAPGHVLPTLCGRPVATDRALVMAIVNRTPDSFYDRGATFSDEA
AMAAVDRAVDEGADLVDIGGVKAGPGTLVDAAEETRRVVPFVEAIRARYPDVIISVDTWR
SEVARLACAEGADLINDTWAGADPGLVEVAAELGAGIVCSHTGGAVPRTRPHRVRYADVV
ADVVDEVVRAAEHATALGVKSDSILVDPTHDFGKNTFHGLELLRRVEDLVNTGWPVLMAL
SNKDFVGETLGVELADRLEGTLAATALAAAGGARVFRVHEVASTRRVVDMVAAIMGTRQP
VRTVRGLA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgcgccccgcctccgacaacgattcggtgacctcggccccctgggcacccggt
cacgtcctgcccacgttgtgcggcaggccggtcgcgaccgatcgtgccctcgtcatggcg
atcgtcaaccgcacccccgactcgttctacgaccgcggcgcgaccttctccgacgaagcg
gcgatggcagccgtcgaccgcgcggtggacgagggggcggacctcgtcgacatcggaggg
gtgaaggccggaccgggcacgctggtggacgccgccgaggagacccgtcgcgtggtcccg
ttcgtcgaggcgatccgcgcgcgctatccggacgtcatcatcagtgtcgacacgtggcgc
agcgaggtcgcgcgccttgcgtgcgccgagggtgccgacctcatcaacgacacgtgggcg
ggcgcggacccgggtctggtggaggtcgccgcggaactgggcgccggcatcgtctgctcg
cacaccgggggagcggtcccgcgtacgcggccgcatcgcgtgcggtacgccgatgtggtc
gccgacgtcgtcgacgaggtggtgcgagcggcagagcacgccaccgcgctgggggtgaaa
tccgactcgatcctcgtcgacccgactcacgatttcgggaagaacaccttccacgggctc
gaattgttgcgccgcgtggaagatctcgttaacaccggatggcctgtcctgatggccctg
agcaacaaggatttcgtcggggagactctaggagtggaactggcggacaggttggagggc
actctggcggccaccgctctcgcggcggccggcggcgcccgcgtgttccgcgtccacgag
gttgcctcgacccgtcgggtggtcgacatggtcgccgcgatcatgggaacacggcagccc
gtccgcaccgtacgggggttggcatga

DBGET integrated database retrieval system