KEGG   Rhodococcus equi: REQ_15050Help
Entry
REQ_15050         CDS       T01352                                 

Gene name
trpB
Definition
tryptophan synthase beta subunit trpb
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
req  Rhodococcus equi
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:req01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:req00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:req00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1565588..1566871)
Genome map
AA seq 427 aa AA seqDB search
MSDTTPIPTHWYNIVADLPVAPPPHLHPGTKEPVTPADLAALFPSALIEQEATTEQYIEI
PEPIREAYRTWRPAPLIRAREFEKALGTPARIYVKYEGVSPVGSHKTNTAVAQAYYNAQD
GVKKITTETGAGQWGSALSFACAKFGIDLEVWQVRASYESKPYRRHLMETYGGTVHPSPS
DLTESGRKMLAEFPDTPGSLGMAVTEAVEVAANDPDARYALGSVLNHVVLHQTVIGLEAV
EQLRNAGEANADVVFGCAGGGSNLAGLAFPFIREVLHGKAQTRIVAAEPAACPSITKGEY
RYDHGDVAGLTPLLKMHTLGQDFVPDPIHAGGLRYHGMAPLLSHTVELGYVTGQAVDQRD
SFDAGVLFARTQGIVPAPESAHAIAAAADYARGLTEPEVLVIGLSGHGMLDLPAYQSHID
GNLVSTA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgacacgacacccatccccacccactggtacaacatcgtcgcggacctgccggtc
gccccgccgccccacctgcacccgggcaccaaggagccggtgaccccggccgacctcgcc
gcgctgttcccgagcgcgctgatcgagcaggaggcgaccaccgagcagtacatcgagatc
cccgagccgatccgtgaggcgtaccgcacgtggcggccggcgcccctgatccgtgcccgc
gaattcgagaaggcgctggggacgcccgctcggatctacgtcaagtacgagggtgtgagc
ccggtcggcagccacaagaccaataccgccgtcgcgcaggcctactacaacgcgcaggac
ggcgtgaagaagatcacgaccgagaccggcgccggccagtggggcagcgcgctgtccttc
gcgtgcgcgaagttcggcatcgatctcgaggtgtggcaggtgcgcgcgtcgtacgagtcc
aagccctaccgccggcacctgatggagacgtacggcggcacggtgcatccgagcccgtcg
gatctgaccgagtcgggtcgcaagatgctcgccgaattccccgacaccccgggttcgctg
ggcatggcggtcaccgaggccgtcgaggtcgccgcgaacgatcccgacgcgcgttacgcg
ctgggcagcgtgctcaaccacgtcgtgctgcaccagacggtgatcgggctcgaggccgtc
gagcagctgcggaacgcgggcgaggccaacgccgacgtcgtgttcggttgcgccggtggc
ggttccaatctcgccgggctcgcgttcccgttcattcgcgaggtgctgcacggcaaggca
cagacccggatcgtcgcggccgagcctgccgcgtgcccgtcgatcaccaagggcgagtac
cgctacgaccacggtgacgtcgccggcctcacgccgctgctgaagatgcacacgctcggc
caggacttcgtcccggacccgatccacgccggcggcctgcgctaccacggcatggcgccg
ctgctcagccacaccgtcgaactcggctacgtcaccggccaggccgtggaccagcgggat
tcgttcgacgcgggcgtgctgttcgcgcgcacgcagggcatcgtgcccgctcccgagtcg
gctcacgcgatcgctgcggccgccgactacgcgcggggcctcaccgagcccgaggtgctg
gtgatcggcctgtccgggcacggcatgctcgacctgcccgcgtaccagtcacacatcgac
ggcaacctggtctccaccgcgtag

DBGET integrated database retrieval system