KEGG   Rhodococcus equi: REQ_15050Help
Entry
REQ_15050         CDS       T01352                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit TrpB
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
req  Rhodococcus equi
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    REQ_15050 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    REQ_15050 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    REQ_15050 (trpB)
Enzymes [BR:req01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     REQ_15050 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1565588..1566871)
Genome map
AA seq 427 aa AA seqDB search
MSDTTPIPTHWYNIVADLPVAPPPHLHPGTKEPVTPADLAALFPSALIEQEATTEQYIEI
PEPIREAYRTWRPAPLIRAREFEKALGTPARIYVKYEGVSPVGSHKTNTAVAQAYYNAQD
GVKKITTETGAGQWGSALSFACAKFGIDLEVWQVRASYESKPYRRHLMETYGGTVHPSPS
DLTESGRKMLAEFPDTPGSLGMAVTEAVEVAANDPDARYALGSVLNHVVLHQTVIGLEAV
EQLRNAGEANADVVFGCAGGGSNLAGLAFPFIREVLHGKAQTRIVAAEPAACPSITKGEY
RYDHGDVAGLTPLLKMHTLGQDFVPDPIHAGGLRYHGMAPLLSHTVELGYVTGQAVDQRD
SFDAGVLFARTQGIVPAPESAHAIAAAADYARGLTEPEVLVIGLSGHGMLDLPAYQSHID
GNLVSTA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgacacgacacccatccccacccactggtacaacatcgtcgcggacctgccggtc
gccccgccgccccacctgcacccgggcaccaaggagccggtgaccccggccgacctcgcc
gcgctgttcccgagcgcgctgatcgagcaggaggcgaccaccgagcagtacatcgagatc
cccgagccgatccgtgaggcgtaccgcacgtggcggccggcgcccctgatccgtgcccgc
gaattcgagaaggcgctggggacgcccgctcggatctacgtcaagtacgagggtgtgagc
ccggtcggcagccacaagaccaataccgccgtcgcgcaggcctactacaacgcgcaggac
ggcgtgaagaagatcacgaccgagaccggcgccggccagtggggcagcgcgctgtccttc
gcgtgcgcgaagttcggcatcgatctcgaggtgtggcaggtgcgcgcgtcgtacgagtcc
aagccctaccgccggcacctgatggagacgtacggcggcacggtgcatccgagcccgtcg
gatctgaccgagtcgggtcgcaagatgctcgccgaattccccgacaccccgggttcgctg
ggcatggcggtcaccgaggccgtcgaggtcgccgcgaacgatcccgacgcgcgttacgcg
ctgggcagcgtgctcaaccacgtcgtgctgcaccagacggtgatcgggctcgaggccgtc
gagcagctgcggaacgcgggcgaggccaacgccgacgtcgtgttcggttgcgccggtggc
ggttccaatctcgccgggctcgcgttcccgttcattcgcgaggtgctgcacggcaaggca
cagacccggatcgtcgcggccgagcctgccgcgtgcccgtcgatcaccaagggcgagtac
cgctacgaccacggtgacgtcgccggcctcacgccgctgctgaagatgcacacgctcggc
caggacttcgtcccggacccgatccacgccggcggcctgcgctaccacggcatggcgccg
ctgctcagccacaccgtcgaactcggctacgtcaccggccaggccgtggaccagcgggat
tcgttcgacgcgggcgtgctgttcgcgcgcacgcagggcatcgtgcccgctcccgagtcg
gctcacgcgatcgctgcggccgccgactacgcgcggggcctcaccgagcccgaggtgctg
gtgatcggcctgtccgggcacggcatgctcgacctgcccgcgtaccagtcacacatcgac
ggcaacctggtctccaccgcgtag

DBGET integrated database retrieval system