KEGG   Rhodococcus equi: REQ_15050Help
Entry
REQ_15050         CDS       T01352                                 

Gene name
trpB
Definition
tryptophan synthase beta subunit trpb
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
req  Rhodococcus equi
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    REQ_15050 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    REQ_15050 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    REQ_15050 (trpB)
Enzymes [BR:req01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     REQ_15050 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1565588..1566871)
Genome map
AA seq 427 aa AA seqDB search
MSDTTPIPTHWYNIVADLPVAPPPHLHPGTKEPVTPADLAALFPSALIEQEATTEQYIEI
PEPIREAYRTWRPAPLIRAREFEKALGTPARIYVKYEGVSPVGSHKTNTAVAQAYYNAQD
GVKKITTETGAGQWGSALSFACAKFGIDLEVWQVRASYESKPYRRHLMETYGGTVHPSPS
DLTESGRKMLAEFPDTPGSLGMAVTEAVEVAANDPDARYALGSVLNHVVLHQTVIGLEAV
EQLRNAGEANADVVFGCAGGGSNLAGLAFPFIREVLHGKAQTRIVAAEPAACPSITKGEY
RYDHGDVAGLTPLLKMHTLGQDFVPDPIHAGGLRYHGMAPLLSHTVELGYVTGQAVDQRD
SFDAGVLFARTQGIVPAPESAHAIAAAADYARGLTEPEVLVIGLSGHGMLDLPAYQSHID
GNLVSTA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgacacgacacccatccccacccactggtacaacatcgtcgcggacctgccggtc
gccccgccgccccacctgcacccgggcaccaaggagccggtgaccccggccgacctcgcc
gcgctgttcccgagcgcgctgatcgagcaggaggcgaccaccgagcagtacatcgagatc
cccgagccgatccgtgaggcgtaccgcacgtggcggccggcgcccctgatccgtgcccgc
gaattcgagaaggcgctggggacgcccgctcggatctacgtcaagtacgagggtgtgagc
ccggtcggcagccacaagaccaataccgccgtcgcgcaggcctactacaacgcgcaggac
ggcgtgaagaagatcacgaccgagaccggcgccggccagtggggcagcgcgctgtccttc
gcgtgcgcgaagttcggcatcgatctcgaggtgtggcaggtgcgcgcgtcgtacgagtcc
aagccctaccgccggcacctgatggagacgtacggcggcacggtgcatccgagcccgtcg
gatctgaccgagtcgggtcgcaagatgctcgccgaattccccgacaccccgggttcgctg
ggcatggcggtcaccgaggccgtcgaggtcgccgcgaacgatcccgacgcgcgttacgcg
ctgggcagcgtgctcaaccacgtcgtgctgcaccagacggtgatcgggctcgaggccgtc
gagcagctgcggaacgcgggcgaggccaacgccgacgtcgtgttcggttgcgccggtggc
ggttccaatctcgccgggctcgcgttcccgttcattcgcgaggtgctgcacggcaaggca
cagacccggatcgtcgcggccgagcctgccgcgtgcccgtcgatcaccaagggcgagtac
cgctacgaccacggtgacgtcgccggcctcacgccgctgctgaagatgcacacgctcggc
caggacttcgtcccggacccgatccacgccggcggcctgcgctaccacggcatggcgccg
ctgctcagccacaccgtcgaactcggctacgtcaccggccaggccgtggaccagcgggat
tcgttcgacgcgggcgtgctgttcgcgcgcacgcagggcatcgtgcccgctcccgagtcg
gctcacgcgatcgctgcggccgccgactacgcgcggggcctcaccgagcccgaggtgctg
gtgatcggcctgtccgggcacggcatgctcgacctgcccgcgtaccagtcacacatcgac
ggcaacctggtctccaccgcgtag

DBGET integrated database retrieval system