KEGG   Rhodococcus equi: REQ_15220Help
Entry
REQ_15220         CDS       T01352                                 

Gene name
pfkB
Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
req  Rhodococcus equi
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    REQ_15220 (pfkB)
   01230 Biosynthesis of amino acids
    REQ_15220 (pfkB)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    REQ_15220 (pfkB)
   00030 Pentose phosphate pathway
    REQ_15220 (pfkB)
   00051 Fructose and mannose metabolism
    REQ_15220 (pfkB)
   00052 Galactose metabolism
    REQ_15220 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    REQ_15220 (pfkB)
Enzymes [BR:req01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     REQ_15220 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1586073..1587104
Genome map
AA seq 343 aa AA seqDB search
MPAIVTLTMNPAVDISTTAERVRTTDKVRCGEPCYDPGGGGINVARIVRVLGETVVAVFP
VGSATGAVLGALLDREGVWNRRVPIAGATRESFTVDERSSGEQYRFVLPGPHLSRVEQEQ
CLSSFAEVARDARYVVASGSLPPGTSPDFYDRVAATARDVGARCLLDTSGESLRHSTSGV
YLLKPSIRELRELSGRSLGQESEQIAAARGLVTAGRCEVVIVSLGARGALMVTQSTATRY
PAIPVAVRSGVGAGDAMLAGIAVGLVRNRSLHDAVRLGIAAGAAMLTTPGTRACRREDIE
AFYDGGAGASVDCEPVDCEPVDRDPVEPGPAESGADDGESLRY
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgatcgtcacactcaccatgaatccggcagtggacatctccacgactgccgaa
cgggtgcggaccaccgacaaggtccgctgcggcgaaccgtgctacgaccccggcggcggg
ggcatcaacgtcgcccgcatcgtgcgggtactgggcgaaacggtcgtcgcggtgttcccg
gtcggatcggccaccggcgctgtcctgggcgcgctgctggaccgggagggcgtgtggaac
cgccgggttccgatcgccggcgccacgcgcgagagcttcaccgtcgacgaacgttcctcc
ggtgagcagtatcggttcgtcctgccgggcccgcacctgagccgtgtcgagcaggagcag
tgcctgtcctcgttcgcggaagtggcccgagacgccaggtacgtcgtcgcaagtggatcg
ctgcccccgggtacctctccggacttctacgatcgggtggctgcgacggcgcgcgacgtc
ggtgcgcgatgcctgctcgacacttcgggagagtcgttgcggcacagcacttccggcgta
tacctcctcaaaccgagcattcgtgagctgcgggagctgtccgggcggagcctggggcag
gaatccgagcagatcgccgcggcccgcggactggtcaccgcgggacggtgcgaggtggtg
atcgtgtcgttgggcgcgcggggcgccctgatggtcacgcagagcaccgccacccgatat
ccggcgatccccgtcgcggtgcgcagcggagtcggcgccggggacgcgatgctcgcggga
atcgccgtcggcctcgtccgcaaccggtccctgcacgacgcggtgcgcctcgggatcgcc
gcgggggccgcgatgctcaccaccccgggcacccgtgcctgccgccgtgaggacatcgag
gcgttctacgacggcggcgcgggtgcgtccgtggactgcgaacccgtggactgcgaaccc
gtggaccgtgacccggtggaacccggccccgcggaatccggagcggacgatggcgagagc
ctccgctactga

DBGET integrated database retrieval system