KEGG   Rhodococcus equi: REQ_16400Help
Entry
REQ_16400         CDS       T01352                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
req  Rhodococcus equi
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:req00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    REQ_16400 (recD)
Enzymes [BR:req01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     REQ_16400 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1712458..1714314
Genome map
AA seq 618 aa AA seqDB search
MIEARVAQRGKGVLREFNEAGVLEAADVHVALRLAMLGGETREPVHLATALAVRAVRSGS
VCLDLSRIREVTVDEEFQIDPAALPWPDDAVVAEGLASSPLVVGGDAGPLRPLRLVDGLL
YLDRYYRQEQTVRRILDERAHGHPTVDEDLLRAGLDELFRDFADPSRPSDAPDRQRIAAA
VAATHWTSVIAGGPGTGKTHTVARVLALLERQQPGLRIGLAAPTGKAAARLQESVREQAD
LVGLRSELPAMTLHRMLGWQRGTSRFRFNETNHLPYDVIVVDETSMVSLTMMCRLLEAVR
PEARLVLVGDPDQLTSVDAGAVLADLVARPVTGVENPVLARVVGADLSASDDPAEAALSA
SERDRLRGGVIRLSRGRRFGGAIAQLAVAVRDGDEDRTLEILRSGAADVSFVDPEDLAGL
RADVVSTSAEVTSAALAGDAAGAVRASEKHRLLCAHREGPFGASWWARNAMTWIGEAMGS
RLDPDRWYAGQPLMVTANDHEMRIYNGDTGVVVADDSDGSDGDLVAAFARGEEPYLVHLS
HLASVQTVYAMTIHRSQGSQYDVVSVILPGEESSLLTRELLYTAITRARTHVRIVGTEAA
VRAAVGRRVLRASGLRRG
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaggcacgggtcgcgcagcgcggcaagggagtgctgcgggagttcaacgaggcc
ggggtgctcgaggccgccgatgtgcacgtcgcgctgcggctcgcgatgctcggcggggag
acccgcgagcccgtgcacctggcgacggcgctggcggtgcgggcggtgcgatcgggctcg
gtgtgcctggacctgagtcggattcgtgaggtgacggtcgacgaggagttccagatcgat
cccgcggcgttgccgtggccggacgacgccgtcgtggccgaggggctggcgtcgagcccc
ctcgtcgtcggcggtgacgccggtccgctgcggccgctgcggctggtggacggcctgctc
tacctggaccggtactaccggcaggaacagaccgtgcgccggatcctggacgagcgcgcg
cacgggcacccgaccgtcgacgaggacctgctgcgggccgggctggacgagttgttccgg
gacttcgcggacccgtcgcggccgtcggatgccccggaccggcagcgcatcgcggcggcc
gtcgcggcgacacactggacgtcggtgatcgcgggcgggccgggcaccggcaagacgcac
acggtggcgcgggtgctggcactgctcgagcggcagcagccggggctgcggatcgggctg
gcggcgcccaccggcaaggcggcggcgcggctgcaggagtcggtgcgcgagcaggcggac
cttgtcggtctgcggtcggagttgccggcgatgacgctgcaccggatgctcggctggcag
cgggggaccagccggttccggttcaacgagaccaaccatctgccgtacgacgtgatcgtg
gtggacgagacgtcgatggtgtcgctgacgatgatgtgtcggctgctcgaggcggtgcgg
ccggaggcgcggctggtgctggtgggtgaccccgaccagttgacgtcggtggatgccggc
gcggtgctcgccgacctggtggcgcggccggtgaccggcgtggagaacccggtgctggcg
cgggtggtgggcgcggacctgtcggcgtcggacgacccggccgaagccgcgctgagtgcg
tcggagcgggaccgcctgcggggcggggtgattcggctcagtcggggtcgtcggttcggc
ggcgcgatcgcgcagctggcggtggcggtgcgcgacggtgacgaggaccgcacgctcgag
attctgcggagcggggcggcggacgtgtcgttcgtcgacccggaggatctggccgggctg
cgcgccgatgtggtgtcgacgtcggcggaggtgacctcggccgcgctggccggggacgcg
gcgggcgcggtgcgggcgtcggagaagcatcggctgctgtgtgcgcaccgggagggcccg
ttcggggcgtcgtggtgggcgcgcaacgcgatgacgtggatcggggaggcgatgggcagc
cggctcgacccggaccgctggtatgccgggcagccgctgatggtgaccgcgaacgaccac
gagatgcggatctacaacggcgacaccggggttgtggtggccgacgattcggacggctcg
gacggcgatctggtcgcggcctttgcgcgcggcgaggagccgtatctggtgcacctgagc
catctggcgtcggtgcagacggtgtacgccatgacgattcaccgcagccagggcagccag
tacgacgtggtctcggtgatcctgccgggcgaggagtcgtcgctgctcacccgggaactg
ctctatacggccatcacccgtgcgcggacgcatgtgcggatcgtcgggaccgaggcggcc
gtgcgggctgctgtggggcgacgggtcctgcgggcgagtgggttgcggcggggctga

DBGET integrated database retrieval system