KEGG   Rhodococcus equi: REQ_16930Help
Entry
REQ_16930         CDS       T01352                                 

Definition
(GenBank) putative branched-chain alpha/keto acid dehydrogenase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
req  Rhodococcus equi
Pathway
req00010  Glycolysis / Gluconeogenesis
req00020  Citrate cycle (TCA cycle)
req00620  Pyruvate metabolism
req01100  Metabolic pathways
req01110  Biosynthesis of secondary metabolites
req01120  Microbial metabolism in diverse environments
req01130  Biosynthesis of antibiotics
req01200  Carbon metabolism
Module
req_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:req00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    REQ_16930
   00020 Citrate cycle (TCA cycle)
    REQ_16930
   00620 Pyruvate metabolism
    REQ_16930
Enzymes [BR:req01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     REQ_16930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl HlyD_3 GCV_H HlyD_D23 Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: CBH47763
UniProt: E4WFQ9
Position
complement(1790725..1791837)
Genome map
AA seq 370 aa AA seqDB search
MSRLEEFRLPDLGEGLTEAELVSWAVAVGDTVELNATIGEVETAKASVELPSPFAGVVRE
LLVQPGTTVPVGTPIIRVETAGDEDEVPPAPRRDAVLVGYGPSAPTVSRRRRPQPHVSRP
PAVRSGAVHARRDAQDARETRTPIRGVRRETAAAMVASAAAAPHVTEFLTVDVTESVRLL
ERLRTAAAFDGLHVTPLTLVAKALLLTLRAHPSLNSAWDEAAQEIVTKHYVNLGIATATE
RGLMVPNVKDADRLPLSELCRAIGALTDTARAGRATPSDLTGGTITITNVGVYGIDTGTP
ILNPGEAAILALGAITRRPWVVGDDIVARDVTTLGLTVDHRLVDGEQASRFLADLGATLH
DPVTCLLALL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcctcgaggagttccggctgcccgacctcggcgagggcctcaccgaggcggaa
ctggtgtcgtgggccgtcgcggtcggagacaccgtcgaactcaacgcgaccatcggggag
gtcgagacagcgaaggcatcggtggaacttccgtcgccgttcgccggggtggtgcgagag
ttgctcgtgcagcccgggaccacggtgccggtcgggacgcccatcatccgcgtcgagacg
gccggcgacgaggacgaggttcccccggctccccgccgggacgcggtgttggtcggctac
ggaccgtcggcgcccaccgtcagcagacgccgacgtccgcagccgcacgtgtcccggcca
ccggcagttcggtcgggcgccgtccacgcccgccgcgacgcccaggacgcccgcgagacg
cggacgccgatccgcggggtgcgacgcgagacggcggcggccatggtcgccagcgccgcc
gccgcaccgcacgtcaccgagttcctcaccgtcgacgtcaccgagtcggtgcggctgctc
gagcgactgcgcacagcggccgcgttcgacggcctgcacgtgaccccgctgacgctggtc
gccaaggccctgctgctgacgctgcgggcgcatccgtcgctgaactcggcgtgggacgag
gccgcgcaggagatcgtcaccaagcactacgtgaacctcggcatcgcgaccgccaccgag
cgaggcctgatggtgccgaacgtcaaggacgcggatcggctgcccctgtccgagctgtgc
cgggcgatcggcgcactcaccgacaccgcgcgggccgggcgggcgacgccgtccgacctc
accggcggaacgatcacgatcaccaacgtcggcgtctacggcatcgacaccggcaccccg
atcctcaacccgggcgaggccgcgatcctcgcgctcggcgcgatcacgaggcggccgtgg
gtggtgggcgacgacatcgtcgcgcgggacgtcacgacactcggcctcaccgtcgatcac
cgcctcgtcgacggcgaacaggcgtcgcggttcctcgcggatctcggggcgacgctccac
gacccggtcacctgcctcctcgccctgctctga

DBGET integrated database retrieval system