KEGG   Rhodococcus equi: REQ_17340Help
Entry
REQ_17340         CDS       T01352                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
req  Rhodococcus equi
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:req00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1831234..1832349
Genome map
AA seq 371 aa AA seqDB search
MSTDVELAADLAERAGKLLLDLRVRELGETPLDKAAAKELGRRGDKAANVLLLDGLAAER
PSDSVLSEESADDAARLDNERVWIIDPLDGSREYGLVGRSDWAVHVALWERGAGITAAAV
AQPARGEVYVSGTARAVPSDRINPRILVSDSRPPAFVDALARRVGGTVEPMGSAGAKAMA
VLRGDADAYVHAGGQWEWDSAAPVGVALAAGLHCSRIDGTPLRYNEPHPYLPDLLICRRD
LAVPLLAGIAEETGGPTDSPRVAMAREYIDSLVTHDTSKVRLARHCHRYENGRRTGESGD
EIRSMLETGGQYRPISAVRDVEFREWGTDVVARFLLDMNTGRDLLTVAITEHFSIPSAEI
EAITAIIEPHP
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccgacgtcgaactcgcagccgacctcgccgaacgggcgggcaaactcctgctg
gacctgcgcgtccgggagttgggggagaccccgctcgacaaggctgccgcgaaggagctg
gggcgacggggcgacaaggctgccaacgtcctgctgctggacgggctggccgccgaacgt
ccgtccgactcggtgctgtcggaggagtctgcagacgatgcggcccgcctcgacaacgag
cgggtctggatcatcgacccgctcgacggttcccgcgagtacggtctggtcggacgatcc
gactgggctgttcacgtcgcgttgtgggagcgcggggcgggcatcaccgcggccgcagtg
gcgcagcccgcgcggggcgaggtgtacgtcagcggaaccgcgcgggccgtgccgtccgac
cggatcaatccccggatcctggtgagcgacagcagaccgcccgccttcgtcgacgccctc
gcacgacgcgtcggcggcacggtcgagccgatgggctcggccggcgccaaggcgatggcc
gtcctgcggggagacgcggatgcgtacgtgcatgccggcggccagtgggagtgggattcg
gcggcaccggtgggcgtcgccctcgccgcgggactgcactgctcccgtatcgacggaact
ccgttgcgctacaacgagcctcatccgtacctaccggatctgctgatctgtcgacgcgac
ctagcggtgccgttgctcgccggcattgcggaggagaccggcggtccgaccgacagtcct
cgggtcgcgatggcccgcgagtacatcgactccctcgtcacccacgacaccagcaaggtg
cgtctcgccaggcactgccaccgttacgagaacggccggcgcacaggagagtccggtgac
gagatccggtcgatgctcgagaccggcgggcagtatcggccgatcagcgccgtccgcgac
gtcgagttccgtgagtggggcaccgacgtcgtcgctcggttcctgctcgacatgaacacc
ggccgggacctcctgaccgtcgcgatcaccgagcatttctccatcccgagtgccgagatc
gaggcgatcacggcgatcatcgagccccacccgtag

DBGET integrated database retrieval system